KEGG   Shigella flexneri 301 (serotype 2a): SF3059Help
Entry
SF3059            CDS       T00097                                 

Gene name
yqhH
Definition
(RefSeq) outer membrane lipoprotein
Organism
sfl  Shigella flexneri 301 (serotype 2a)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LPP Cluap1 CLZ ZapB DUF16 DUF1993 DUF4201 DivIC Alanine_zipper Tropomyosin_1 DUF5082 Lebercilin PI3K_P85_iSH2 Glutaredoxin2_C Lzipper-MIP1 TMF_DNA_bd IncA Mnd1 DUF3138 SlyX ABC_tran_CTD Vac_Fusion DUF4988
Motif
Other DBs
NCBI-GeneID: 1026673
NCBI-ProteinID: NP_708830
UniProt: P65299 A0A226KEY9
Position
3154067..3154324
Genome map
AA seq 85 aa AA seqDB search
MKTIFTVGAVVLATCLLSGCVNEQKVNQLASNVQTLNAKIARLEQDMKALRPQIYAAKSE
ANRANTRLDAQDYFDCLRCLRMYAE
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgattttcaccgtgggagctgttgttctggcaacctgcttgctcagtggctgc
gtcaatgagcaaaaggtcaatcaactggcgagcaatgtacaaacattaaatgccaaaatc
gcccggcttgagcaggatatgaaagcactacgcccacaaatctatgctgccaaatccgaa
gctaacagagccaatacgcgtcttgatgcacaggactattttgattgcctgcgctgcttg
cgtatgtacgcagaatga

DBGET integrated database retrieval system