KEGG   Shigella flexneri 301 (serotype 2a): SF3098Help
Entry
SF3098            CDS       T00097                                 

Gene name
uppP
Definition
(RefSeq) undecaprenyl pyrophosphate phosphatase
  KO
K06153  undecaprenyl-diphosphatase [EC:3.6.1.27]
Organism
sfl  Shigella flexneri 301 (serotype 2a)
Pathway
sfl00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:sfl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SF3098 (uppP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sfl01011]
    SF3098 (uppP)
Enzymes [BR:sfl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.27  undecaprenyl-diphosphate phosphatase
     SF3098 (uppP)
Peptidoglycan biosynthesis and degradation proteins [BR:sfl01011]
 Precursor biosynthesis
  Diphosphatase
   SF3098 (uppP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BacA
Motif
Other DBs
NCBI-GeneID: 1026703
NCBI-ProteinID: NP_708867
UniProt: P67387 A0A226KF81
Position
complement(3192416..3193237)
Genome map
AA seq 273 aa AA seqDB search
MSDMHSLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDTAKTFEVVIQLGSILAV
VVMFWRRLFGLIGIHFGRPLQHEGESKGRLTLIHILLGMIPAVVLGLLFHDTIKSLFNPI
NVMYALVVGGLLLIAAECLKPKEPRAPGLDDMTYRQAFMIGCFQCLALWPGFSRSGATIS
GGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWGFLTTGDIPMFAVGFITAFVVALI
AIKTFLQLIKRISFIPFAIYRFIVAAAVYVVFF
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatatgcactcgctgctgatagcggcaatattgggtgtggtcgaaggattgaca
gaatttctgccggtatccagcacgggccatatgattattgtcggtcacttgttggggttt
gagggcgacacggcgaaaacctttgaagttgtgatccagttaggatcaattctggcggta
gtagtgatgttctggcggcgtctgtttggcctgattggcatccactttggccgcccgttg
cagcacgaaggtgaaagcaaaggtcgtttaacgctgatccacattttgctggggatgatt
ccggcggtggtactggggctattattccacgacacgattaagtcattgtttaacccgata
aatgtgatgtatgcgctggtcgttggcggtttgttgctgattgccgccgaatgcctgaag
ccgaaagagccgcgtgcgccgggtcttgatgatatgacctatcgtcaggcgtttatgatt
ggctgtttccagtgtctggcgctgtggccgggtttctcccgttccggggcgaccatttca
ggtgggatgctgatgggcgtgagccgttacgctgcttccgagttctcgttcctgctggcg
gtaccgatgatgatgggcgcaacggcgctcgatctctacaaaagctggggcttcctgaca
accggcgatatcccgatgtttgccgttgggtttatcaccgcttttgtggtggcgctgata
gcgattaaaaccttcctgcaattgattaagcgcatttcgtttatcccgttcgccatttat
cgctttattgtggcggctgcggtgtatgtcgtgttcttttga

DBGET integrated database retrieval system