KEGG   Shigella flexneri 301 (serotype 2a): SF3347Help
Entry
SF3347            CDS       T00097                                 

Gene name
rplV
Definition
(RefSeq) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
sfl  Shigella flexneri 301 (serotype 2a)
Pathway
sfl03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sfl00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SF3347 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sfl03011]
    SF3347 (rplV)
Ribosome [BR:sfl03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    SF3347 (rplV)
  Bacteria
    SF3347 (rplV)
  Archaea
    SF3347 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Mic1 Peptidase_U40
Motif
Other DBs
NCBI-GeneID: 1026990
NCBI-ProteinID: NP_709103
UniProt: Q83PY5
Position
complement(3434284..3434616)
Genome map
AA seq 110 aa AA seqDB search
METIAKHRHARSSAQKVRLVADLIRGKKVSQALDILTYTNKKAAVQVKKVLESAIANAEH
NDGADIDDLKVTKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSDR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaactattgctaaacatcgccatgctcgttcttctgctcagaaggttcgccttgtt
gctgacctgattcgcggtaagaaagtgtcgcaggctctggatattttgacctacaccaac
aagaaagcggctgtacaggtcaagaaagttctggaatctgccattgctaacgctgaacac
aacgatggcgctgacattgacgatctgaaagttacgaaaattttcgtagacgaaggcccg
agcatgaagcgcattatgccgcgtgcaaaaggtcgtgcagatcgcatcctgaagcgcacc
agccacatcactgtggttgtgtccgatcgctga

DBGET integrated database retrieval system