KEGG   Shigella flexneri 301 (serotype 2a): SF3957Help
Entry
SF3957            CDS       T00097                                 

Gene name
yihX
Definition
(RefSeq) alpha-D-glucose-1-phosphatase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
sfl  Shigella flexneri 301 (serotype 2a)
Pathway
sfl00010  Glycolysis / Gluconeogenesis
sfl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sfl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SF3957 (yihX)
Enzymes [BR:sfl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     SF3957 (yihX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Acid_PPase HAD PNK3P
Motif
Other DBs
NCBI-GeneID: 1025513
NCBI-ProteinID: NP_709685
UniProt: P0A8Y4
Position
4088197..4088796
Genome map
AA seq 199 aa AA seqDB search
MLYIFDLGNVIVDIDFNRVLGAWSDLTRIPLASLKKSFHMGEAFHQHERGEISDEAFAEA
LCHEMALPLSYEQFSHGWQAVFVALRPEVIAIMHKLREQGHRVVVLSNTNRLHTTFWPEE
YPEIRDAADHIYLSQDLGMRKPEARIYQHVLQAEGFSPSDTVFFDDNADNIEGANQLGIT
SILVKDKTTIPDYFAKVLC
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgctctatatctttgatttaggtaatgtgattgtcgatatcgactttaaccgtgtgctg
ggagcctggagcgatttaacgcgtattccgctggcatcgcttaagaagagttttcatatg
ggggaggcgtttcatcagcatgagcgtggggaaattagcgacgaagcgttcgcagaggcg
ctgtgtcatgagatggctctaccgctaagctacgagcagttctctcacggctggcaggcg
gtgtttgttgcgctgcgcccggaagtgatcgccatcatgcataaactgcgtgagcagggg
catcgcgtggtggtgctttccaataccaaccgcctgcataccaccttctggccggaagaa
tacccggaaattcgtgatgctgctgaccatatctatctgtcgcaagatctggggatgcgc
aaacctgaagcacgaatttaccagcatgttttgcaggcggaaggtttttcacccagcgat
acggtctttttcgacgataacgccgataatatagaaggagctaatcagctaggcattacc
agtattctggtgaaagataaaaccaccatcccggactatttcgcgaaggtgttatgctaa

DBGET integrated database retrieval system