KEGG   Sphingorhabdus flavimaris: SPHFLASMR4Y_02675Help
Entry
SPHFLASMR4Y_02675 CDS       T04949                                 

Gene name
fadA
Definition
(GenBank) putative acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sfla  Sphingorhabdus flavimaris
Pathway
sfla00071  Fatty acid degradation
sfla00072  Synthesis and degradation of ketone bodies
sfla00280  Valine, leucine and isoleucine degradation
sfla00310  Lysine degradation
sfla00362  Benzoate degradation
sfla00380  Tryptophan metabolism
sfla00620  Pyruvate metabolism
sfla00630  Glyoxylate and dicarboxylate metabolism
sfla00640  Propanoate metabolism
sfla00650  Butanoate metabolism
sfla00900  Terpenoid backbone biosynthesis
sfla01100  Metabolic pathways
sfla01110  Biosynthesis of secondary metabolites
sfla01120  Microbial metabolism in diverse environments
sfla01130  Biosynthesis of antibiotics
sfla01200  Carbon metabolism
sfla01212  Fatty acid metabolism
sfla02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sfla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SPHFLASMR4Y_02675 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    SPHFLASMR4Y_02675 (fadA)
   00640 Propanoate metabolism
    SPHFLASMR4Y_02675 (fadA)
   00650 Butanoate metabolism
    SPHFLASMR4Y_02675 (fadA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SPHFLASMR4Y_02675 (fadA)
   00072 Synthesis and degradation of ketone bodies
    SPHFLASMR4Y_02675 (fadA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SPHFLASMR4Y_02675 (fadA)
   00310 Lysine degradation
    SPHFLASMR4Y_02675 (fadA)
   00380 Tryptophan metabolism
    SPHFLASMR4Y_02675 (fadA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SPHFLASMR4Y_02675 (fadA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SPHFLASMR4Y_02675 (fadA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SPHFLASMR4Y_02675 (fadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sfla04147]
    SPHFLASMR4Y_02675 (fadA)
Enzymes [BR:sfla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SPHFLASMR4Y_02675 (fadA)
Exosome [BR:sfla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SPHFLASMR4Y_02675 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ASK89413
UniProt: A0A220W9B0
Position
2746379..2747551
Genome map
AA seq 390 aa AA seqDB search
MAEAYIVDAVRTAGGRRGGRLAGVHPVDLGAATLDAIADRNDFDPSAIEDVITGCVMQGG
EQSGDVGRNAVLASRLPDSIPSVSIDRQCGSSQQSIQFAAQGVMSGTQDMVLAHGIESMT
RVPMGSTFKLFKDAGLGTNKSERLEEAYPGVHFSQFMGAEMIVKKHGFTREQLDEFALES
HQKAIKATESGAFDNEIVGVKIETPEGEEIHKVDEGIRFDASMESISGVKVLQEGGAITA
ANASQICDGSSAVLVCSEQALKDHGLTPRARIVNLTVTAGDPVIMLEEPLFATDRALQRA
GMNIGDIDLYEVNEAFAPVPLAWLKHVGADRARINVHGGAIALGHPLGASGTKLMATLLN
ALEQSGGKYGLQTMCEGGGQANVTIIERLG
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagcctatattgttgacgcggttcggaccgctggtggtcgtcgtggcggccga
ttggccggtgtgcacccggtagacctgggcgctgctacgcttgacgccatcgccgatcgc
aatgatttcgatccgagcgctatcgaggatgttatcaccggctgcgtcatgcagggcggc
gagcaaagcggcgatgtcggccggaatgccgttctcgcgtcccggctgccggacagcatt
ccgtcggtttccatcgaccggcaatgcggttcctcgcagcagtcgatccagttcgccgcg
cagggcgtcatgtccggcacgcaggacatggtgctggcccacggtatcgaaagtatgact
cgcgtacccatgggttcgaccttcaaactgttcaaggatgccggtctcggcaccaacaag
tcggagcgtctcgaggaagcctatccgggcgtccatttcagccagttcatgggcgcggaa
atgatcgtcaagaaacatggcttcacgcgcgagcagctcgacgagttcgctctggaaagt
caccagaaggcgatcaaggccaccgaatccggtgcctttgacaacgaaattgtcggcgtg
aagattgaaacgccggaaggtgaggaaatccacaaggtcgacgagggcatccgcttcgac
gccagcatggaaagcatcagcggagtgaaagtgttgcaggaaggcggcgccatcaccgca
gccaatgccagccagatttgcgacggttcgagcgcggttctcgtctgttccgaacaggcg
ctgaaagaccatggcctgaccccgcgcgcgcggatcgtcaatctgaccgtgaccgcgggc
gacccggtgatcatgctcgaggaacccctgttcgcgaccgaccgtgccctgcagcgcgcc
ggcatgaatatcggcgacatcgatctttatgaagtaaacgaggcctttgcccctgttccg
ctcgcatggctcaagcatgttggtgctgaccgtgccagaatcaatgtccatggcggcgcg
attgctctcgggcacccgcttggcgcttccggtaccaaattgatggcgaccctgctcaac
gcactggaacagagcggtggcaaatatggcctgcagacgatgtgcgaaggcggcggccaa
gccaatgtcacgatcatcgaacgactgggctag

DBGET integrated database retrieval system