KEGG   Scleropages formosus (Asian bonytongue): 108918227Help
Entry
108918227         CDS       T04919                                 

Gene name
espl1
Definition
(RefSeq) separin
  KO
K02365  separase [EC:3.4.22.49]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm04110  Cell cycle
sfm04114  Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108918227 (espl1)
   04114 Oocyte meiosis
    108918227 (espl1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sfm01002]
    108918227 (espl1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sfm03036]
    108918227 (espl1)
Enzymes [BR:sfm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     108918227 (espl1)
Peptidases and inhibitors [BR:sfm01002]
 Cysteine peptidases
  Family C50: separase family
   108918227 (espl1)
Chromosome and associated proteins [BR:sfm03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Separase
    108918227 (espl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C50 CHAT
Motif
Other DBs
NCBI-GeneID: 108918227
NCBI-ProteinID: XP_018580856
Position
22
AA seq 2195 aa AA seqDB search
MMKCLKVEEYLKWTASSRETDVLRADLEDYVKRGLRPDGRTLCDRVIRACNQQLGMGTVD
SKHLAKLVSLVQLALRGYESVEEPGLQSSPLYMEKILFHIMKKLVSQGTPQHSQLLGSLL
YKRLAVSKRSAFSTEMEDFCVLVRSCFVVLWNGVTGTQPNPVILPRERLQRHIQALSFLL
LLEGLSDTSPFSSKVAVYTEDALIEFVKSCGTLSENDASYLLQEIKHYLIPTQKPGKNPA
PEKWFAVCEVLVHTCRLLFKANHWVHALDLVTGVREWLRDSSCLDAFLELAQQAVEIHRF
HQSEEENSKALTDCARIVRGLPSLGDQECHVILQVCQLIVSALEMNQNKGHDGKYLLTWF
SFLEEYQELISRHLCKVTALPADKKRMFQQQLFCTMCQGFTSAYDSMVAFQLEDGETLER
VLLYCKATAAEMMNKLQNLASDSFFNKAASAVNSMACALYNRRMYDQAFAIVETLCRELM
KNNHPSLSVEKLNRAFLLAVQSSRKRGQLDCALDWVVYWLQALGDQIMTHMAEPITLWVK
TKADAARGGEEDMRLRTLRDGFGANVPEEGVMLSLLEEELRAYREVAGDTAQERYNVLCD
LLDICHEGSMHTHRRAVYLYEMAQVVCFQDFSEQTDCSAVDFTVESLRLLNEEQETAENT
DQLMDDKAQASLWLYICTLEKNLQDAMDFDRKRSKAQEQRLSLEPVGTNDLDYEDKQKQQ
DSQLVYEGLCFNLTAERKCSEPLDKALELWRNLLAKDTVPVIRTPKQTVSSIVLMAALYK
LMGKPLRALESHQLAVGFSHKLSDAISCASSMCYSARLLLEMGTPELAQLQLEQAEKLLP
PVDSSSEGISPLHVFATLVRAELCYRTNQVEKGVSHLCQVLKEVGEQRHSKSWYLLRARA
LQTASAYLGLDVTSLPSNLRQRITEYGLKTPDTTLYDSLKLLCSLVVTLVGNGLYGTNVG
VDTRFVDQGDNVLLKWQLLAEVLSCSFRMVAVRRLSGAVHEAKVQCLEALKLTTKLQTLS
QCAEFLVMKAELELQKGESTPSGMDLEQVKDLLDLCTDFTSKTKKMEVKIKPRKGRPAKK
PACPAPVDDDCSDLLKTRSFFQQPVAAVDEWAQSASPKLRSKDMGWLVSLGHKADCCCLC
CSDPGLGRVCVRWAAAQAELALHLHQGVGAVQSQKLFLTALSHCRSVTAKLSAELFRLMP
AKDKPYPSFLDDLMGRIYLRMSLSSLELPLQKSASVWELLDSGFAFVASRSSPELESIRV
SLQATKALAYIITLAAQNKCRPEELFSAMWTWNPMVKAHQKAKVLWSNTKAKDPVTSSKA
KEVKKVKDPGVSITCQETKMPKDMTVHLTTPKVKMAFPSSKNRSLSCKTPHVTKMSKSKS
ATRGQSCAFDFDNEVPQIAVRPHTPPVPCTPVQKVKTVPPGRQGAMKPAPKLQFQVYNES
SPPEAHLAPVPAAPRRSTRSRFKVEFSDESDVETSTLAVNADKQKASKLRASSKVATTSK
PKVQPPTDKRAVKGRGKAKKSTVLPAHNISSEEELVPCAPRKGRCKKQSDIAASAAETEE
LEQMRTIKEEEYRMDTSVEELKISDAEENETLGKSKEHNDADLEVLRRDLWADLEKDSFG
HFRRGDHSGIQPSYATIPSSGPDGLTLELVRDLLCSTLLSLQHFPPLWIYPRLCGLLALA
QGDLLTTAMLHSQSLGITARHHMTRHLATRLKKLKKDCSSDLVDKLDSLSLDDACAQMPL
HQKLTELERIFTFPTTDPSAFPHQHCEDFTQQLKMIPSGVTVCLLSVVGVQPREIGDTVL
LTRLERDASPVTVCIPTAQLECPVSAVIQEMDNVQKQQKVVSSVADKAQWWEGRRSLDTR
MERLLDKMKMILGCWQGLLLPVTCDPELSSQVKNLSQTLSEFGVHATKELLKVVLSASPL
LSQQDLHALASGLCPERAAELVSLLQVAVSALSNRAEPQGHTVLILDKYLQKLPWESISC
LRSHSVTRMPSLHFLIGHCLSKKLDPTSVLNVGVDLKKVFYVLNPDANLKDTEERFKEWF
AKEPAWKGVCGTAPNPTELQEAVTTKDLYIYVGHGAGARFLDGQRILKEDLHAASLLFGC
SSAALAVYGELEGSGIILNYLMAGCPLILGNLWDVTDRDIDRFTKALLQSWFSAGPGAAL
LNHMASSRQATHLKYLIGAAPVVYGLPVSLQKEEC
NT seq 6588 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagtgcctaaaagtggaagagtatctcaagtggacggcctcttcccgagaaacg
gacgttctgcgcgcagatctcgaggactatgtcaagagaggtttgagaccagatggcaga
acactgtgtgacagagtaataagagcctgcaaccaacagctggggatggggacagtggac
agcaaacatcttgcaaaacttgtgtcacttgtccagctcgccctccgtggttatgagagt
gtagaggagccggggttgcagagcagccctttatacatggagaagattcttttccacata
atgaaaaagctggtcagtcagggaacaccccagcatagtcagctgcttggaagcctgttg
tacaaaagactggctgtttccaaaagatcagctttctccactgaaatggaagacttttgt
gtactggtccgaagctgctttgtggttttgtggaacggggtaacaggaacacagcctaat
cctgtcattctcccccgggaaagactccagcgtcacattcaagctctgagttttctcttg
ctgttggaagggttgtctgatacgtcaccgttttcttctaaagttgctgtgtatactgaa
gatgccctgattgaatttgtgaaaagctgtgggactttgtcagagaatgatgcttcatat
ctgctccaagaaatcaaacactatctcatcccaacacaaaaacctgggaagaaccccgca
cctgagaagtggtttgctgtgtgtgaggtgctggtgcatacttgcagacttctgttcaag
gcaaatcactgggtccatgcacttgaccttgttacaggagtcagagaatggctgagagat
tcttcctgcctagatgcatttctggaacttgcccaacaggctgtcgagatccaccgcttt
caccagtctgaagaggagaattctaaggctttgactgactgtgcccgcattgtccgtggc
ctcccctctttgggtgatcaggaatgtcatgtcatcttacaagtctgccagcttattgtt
tcagcacttgagatgaatcagaacaagggacacgatgggaagtatctcctgacttggttc
tcattcctggaagaataccaagagctcattagcaggcacctttgcaaggttacagcgctg
cctgccgataagaagcgcatgtttcaacagcaattgttctgcacaatgtgccaaggattc
acaagtgcttatgacagcatggtagcttttcagttggaggatggtgagacccttgaaagg
gtgctgttgtactgcaaggccacagctgctgagatgatgaacaaattgcaaaacctggct
tctgacagtttcttcaataaagctgcctctgcagtgaatagcatggcttgtgcgctttac
aaccgcagaatgtatgaccaggcctttgccatcgtggagactctgtgccgtgagctcatg
aagaacaatcacccctcgctttctgtggaaaagttgaatcgagctttcctgctagcagtc
cagagctcaagaaaacgtggtcaattggactgtgctctagactgggtggtgtactggctg
caggccctgggtgaccagatcatgacccacatggcagagccaatcactttgtgggttaaa
accaaagcagatgctgccagaggaggggaggaagacatgcgacttaggacacttcgtgat
ggctttggtgctaatgtcccagaggaaggagtgatgctctccctcttggaagaggaactc
agagcctatagggaggttgcaggtgacactgctcaggagcgctacaatgtactgtgtgac
ttgctggacatctgccatgaaggcagcatgcatacacaccgaagagcagtctacctgtat
gagatggcccaggtggtctgcttccaggacttcagtgagcagactgactgttctgctgta
gatttcactgttgagtctttacggctgctgaatgaggagcaagaaactgctgagaacact
gaccagctcatggatgacaaagcccaggcctccctctggctctacatttgtacactggag
aagaacctccaagatgctatggattttgacaggaagcgatccaaggcacaggagcaaaga
ctcagcttggagcctgtaggaaccaatgacttggactatgaagacaaacagaagcagcag
gatagccagctggtctatgaaggactatgcttcaacttgactgctgagagaaagtgttct
gagcctcttgacaaggccctggagctgtggagaaacctgctagccaaggacacagtccct
gttatacgaacacccaagcagacagtctcttccattgttcttatggctgcactatacaaa
ctcatgggcaagcctctgcgtgctttggagagccaccagttggctgtgggcttttcgcat
aaacttagtgatgctattagctgtgccagctccatgtgctactctgctaggctgctcctg
gagatgggcacccctgaactggcacagctgcagctagaacaggcagagaagttgctgcct
cctgttgactccagttctgagggcatctcgcccctccacgtgttcgccacccttgtaaga
gctgagctctgctacaggaccaaccaggtggagaaaggggtttcccatctgtgtcaggta
ttgaaggaggtgggagaacagaggcactctaagagctggtatctgttgcgagccagggct
cttcagacagctagcgcctaccttggccttgatgtcacttctctgccaagcaacttgcga
caaagaattaccgaatatggactgaagacccctgacacaacactatatgatagtttgaag
ttgctgtgtagcctggtggtgaccttggtgggaaatggtctctatggaactaatgtcgga
gtggacacacgctttgttgaccaaggagacaatgtcttactgaagtggcagttactggct
gaagtcttgagttgttcctttcggatggtggcagtgaggagacttagtggggcagtacat
gaagccaaggtgcagtgcctggaagccttaaagctcaccacgaaactgcaaacgcttagc
caatgtgcggaattcttggtgatgaaggcagagttggagctacagaaaggggagagtaca
ccgagtggcatggaccttgagcaagttaaggaccttcttgacctttgtactgattttact
agcaaaactaagaagatggaagtcaaaatcaaaccacggaaggggagaccagctaaaaaa
ccagcatgtcctgcaccagtggatgatgactgcagtgaccttctgaagaccaggtctttc
tttcagcaaccagtggcagctgttgatgagtgggctcagagtgcctctcctaagctccgg
tccaaggacatgggttggcttgtctctttgggacacaaggcagactgctgctgcctgtgc
tgttcagaccctgggttgggacgtgtctgtgttcgctgggctgcagcccaggcagagctg
gctcttcatttacaccaaggtgtaggagcagtacagagccagaagctcttccttactgct
ctttcacattgcaggagtgtgactgcaaagctttctgccgaactattccgcctgatgcct
gcaaaggacaagccttacccatccttcctcgatgatcttatggggagaatctacttacgc
atgtccctttctagtcttgagttgccattacagaagtctgccagtgtatgggagctccta
gactcaggctttgcctttgtagcttcaagaagctcccctgagctggagtccatccgggtg
agcctgcaggcaaccaaagcccttgcttacattattacattggcagcccagaataaatgc
agaccagaagagctcttctctgctatgtggacatggaatcccatggtcaaggctcatcag
aaagctaaagttttgtggtctaacacaaaagccaaggatcctgttacctcttcaaaagca
aaagaggtcaagaaagtcaaggaccctggggtttccataacatgtcaagagacaaagatg
cccaaagatatgacagtgcatttgacaacacccaaggttaagatggcatttccttcatcc
aaaaacaggtctttgtcctgcaaaaccccacatgtaaccaaaatgtcaaaatcaaagtct
gcaacacgaggacagtcatgtgcttttgactttgacaatgaagtaccccaaattgctgta
aggccacacactcccccagtaccatgcacacctgttcaaaaagtgaagacagtacctcct
ggaaggcaaggtgcaatgaagcctgccccaaagttgcagttccaggtgtacaatgaatct
tctcctccagaggcccatctagcaccagtacctgctgctcccagacgaagcacaaggtct
cgctttaaggtggaattcagtgatgagagtgatgtggagacctctactctagcagtaaat
gctgacaagcaaaaagccagcaagttgcgtgcatcttccaaagtggctaccacgtccaaa
cccaaggtgcaaccaccaactgataagagggccgtgaaaggacggggaaaagcaaaaaaa
agcactgtcctccctgcccacaacatatcttctgaggaagagctagtcccctgtgcccca
cggaagggcaggtgtaagaaacagagtgacattgctgctagtgctgcagaaacagaagag
ctggagcagatgaggaccataaaagaagaggaatatagaatggatacaagtgtggaggag
ctaaagatatctgatgcagaggaaaatgagacattgggaaaatcaaaggagcataatgat
gcagatcttgaggtgcttagacgagatctttgggcagacctggagaaggatagttttggt
cacttcagaagaggtgaccattctgggatccagccatcatatgcaacaatccctagctca
ggaccagatggtctgacactggagttggtgagggaccttctgtgcagcacattgctgtcc
ctgcaacatttccctccgctttggatatatccccggctctgtgggttgcttgccttggcc
cagggagacctactgaccactgccatgcttcactcccagtccttggggatcacagcaagg
catcacatgactcgtcaccttgccacaagactgaagaagctgaaaaaggattgttcctct
gatcttgttgataagctggactccttgagtctagatgatgcctgtgcacaaatgccactg
catcagaagctaacagagttggagaggatcttcacctttcccaccactgacccttcagct
ttccctcaccaacattgtgaagacttcacacagcagctcaagatgatcccttcaggtgtg
acagtgtgccttctttctgtggttggtgtccagcccagggagattggagatactgttctg
ctgacccgtttagaaagggatgcctctccagtcactgtttgcattcccactgcacagctt
gagtgtccagtgagtgctgtgatccaggaaatggacaatgttcagaaacagcagaaggtg
gtgagcagtgtggcagacaaagcacagtggtgggagggccggcgatcactggatacccgc
atggagaggttgttggataaaatgaagatgattttgggctgctggcagggattgctgtta
cctgtcacgtgtgatccagagctctccagtcaggttaagaacctttcccagactctttca
gagtttggtgtccacgccacaaaagagctgctcaaggtggtgctgtctgcctccccactg
ctctctcaacaagatctacatgccctggctagtggtttgtgcccagaaagagctgcagag
ctggtctccctcctgcaggtggcagtctctgcactgagcaacagagcagagccacaaggc
cacactgtcctcatcctggacaagtatctgcaaaagcttccatgggaaagtatctcctgc
ctgaggtcccactcagtcacccgtatgccttccctgcacttccttattggccactgtctc
tctaaaaagctggatcctacatcagtactaaatgttggagttgacctgaagaaggtattc
tatgtgcttaaccctgatgccaatctgaaagacacagaggaacgcttcaaagagtggttt
gccaaagagcctgcttggaagggtgtgtgtggaactgctccgaacccaactgagcttcaa
gaagcagtgaccactaaagacctctatatctacgtgggtcatggagcaggggcacggttc
ttggatgggcagcggatcctaaaagaggacttgcatgcagcctcgctgctgtttggttgc
agcagtgctgctttggcagtctatggagagctagaaggttctggaataatcctaaattac
ctaatggctggctgtccactgattcttggcaacctttgggatgtgacggatcgtgacatt
gatcgctttacaaaggccctgcttcagtcgtggttttcagctggtccgggggctgctctt
ctcaaccatatggcctcctctcgccaggccacacatctgaaatacctgatcggtgcagca
cctgtagtgtatggcctgcctgtgtccttgcagaaagaggaatgttaa

DBGET integrated database retrieval system