KEGG   Scleropages formosus (Asian bonytongue): 108918425Help
Entry
108918425         CDS       T04919                                 

Definition
(RefSeq) activin receptor type-1B-like isoform X1
  KO
K13567  activin receptor type-1B [EC:2.7.11.30]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm04060  Cytokine-cytokine receptor interaction
sfm04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    108918425
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108918425
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sfm01001]
    108918425
Enzymes [BR:sfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     108918425
Protein kinases [BR:sfm01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   108918425
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TGF_beta_GS Activin_recp Pkinase_fungal APH FTA2 Haspin_kinase Insulin_TMD
Motif
Other DBs
NCBI-GeneID: 108918425
NCBI-ProteinID: XP_018581139
UniProt: A0A1W4XNK3
Position
Unknown
AA seq 523 aa AA seqDB search
MVVGSRTERSSSGCSTSWGVRRSCLTTLRCNCTECLGTDQCVTDGACIASTSVIEGQERH
VRTCITRDQLQPPGQPFYCLSAEGLLNTHCCYTDYCNSVNLKVPSVTKPGDGLGPGAKWG
PVELVAVIAGPVFLLCLLLIVGVFLFHHHHQRVYSHRQRLGVEDPSCDHLYLAKDKTLQD
LIFDLSTSGSGSGLPLFVQRTVARTIVLQEVIGKGRFGEVWRGKWRGGDVAVKIFSSREE
RSWFREAEIYQTIMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYSVTI
EGMIKLALSAASGLGHLHMEILGTQGKPGIAHRDLKSKNILVKKNGTCAIADLGLAVRHE
SATDTIDIAPNQRVGTKRYMAPEVLDETINMKHFDSFKCADIYALGLVYWEIARRCNAGV
IHEEYQLPYYDLVPSDPSIEEMRKVVCEQKLRPNVPNWWQSYEVSSCPHIHCLLVSRKMK
LGIFSSRLFSEMCACCPAKAGITLFRLNSTVFTAHFQHMSFSQ
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggttgtcggcagtcgcaccgaaaggtcttcttcgggctgctctacatcctggggtgtg
cggcgctcgtgcttgacaaccctgcgatgcaactgcacggagtgcttgggtacagaccag
tgtgtgacggacggggcctgcatcgcgtccacctcagtcatcgagggccaggagcgccac
gtgcgcacgtgcatcacgcgagaccagctgcagccaccggggcagcccttctactgcctg
agtgccgaggggctgctcaacacccactgctgctacaccgactattgcaacagtgtgaac
ctaaaggtcccttcggtcacgaagcccggtgatggactgggcccgggtgccaaatggggc
ccggtggagctggtggccgtgatcgcagggcccgtcttcctgctgtgtctgctgctcatt
gtgggcgtcttcctgttccaccaccaccaccagcgagtatacagccaccggcagcggctc
ggggtggaagacccctcctgcgaccacctgtacctggccaaggacaagacgctccaggac
ctcatctttgatctctccacctccggatcaggctctgggctgccgctctttgtgcagcgg
actgtggctcgtaccattgtgctgcaggaggtcatcgggaagggccgcttcggcgaggtt
tggcggggcaagtggcgcgggggcgacgtggctgtcaagatcttctcgtcccgggaagaa
cgctcctggttccgggaggctgagatctaccaaaccatcatgctgcggcacgagaacatc
ctgggcttcattgccgctgacaacaaggacaacggcacctggacccagctgtggctcgtg
tccgactaccacgaacacggctcccttttcgactacctgaaccgctactcggtcaccatc
gagggcatgatcaagctggcgctgtccgctgccagcggcttgggccacctgcacatggag
atcttgggcacgcaggggaagccaggcatcgcccaccgagacctcaagtctaagaacatc
ctcgtgaagaagaatggcacctgtgccatagccgacctggggctggccgtgcgccacgag
tccgccaccgacaccatcgacatagcccccaaccagcgtgtgggcaccaaaaggtatatg
gctccggaggtgctggatgaaaccatcaacatgaaacactttgactcgttcaagtgtgcc
gatatttacgccctgggactggtgtactgggagatcgcccggcgttgcaacgcaggagtt
attcatgaggagtaccagctgccctactacgacctagtgccctctgacccctccattgag
gagatgaggaaggtagtgtgtgaacagaagctgcggcccaatgtgcccaactggtggcag
agctatgaggtgagtagttgccctcacattcactgtctccttgtgtcacgaaagatgaag
ttgggaattttcagctctcgtctgttttctgaaatgtgtgcatgttgcccagctaaggca
gggatcaccttatttcgactcaactccacagtgtttacggctcacttccagcatatgagt
ttcagtcaatga

DBGET integrated database retrieval system