KEGG   Scleropages formosus (Asian bonytongue): 108919335Help
Entry
108919335         CDS       T04919                                 

Definition
(RefSeq) 5-beta-cholestane-3-alpha,7-alpha-diol 12-alpha-hydroxylase-like
  KO
K07431  sterol 12-alpha-hydroxylase [EC:1.14.18.8 1.14.14.139]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00120  Primary bile acid biosynthesis
sfm01100  Metabolic pathways
sfm03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    108919335
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    108919335
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:sfm00199]
    108919335
Enzymes [BR:sfm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.139  5beta-cholestane-3alpha,7alpha-diol 12alpha-hydroxylase
     108919335
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.8  7alpha-hydroxycholest-4-en-3-one 12alpha-hydroxylase
     108919335
Cytochrome P450 [BR:sfm00199]
 Cytochrome P450, animal type
  CYP8 family
   108919335
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 108919335
NCBI-ProteinID: XP_018582773
Position
7
AA seq 511 aa AA seqDB search
MHVLLPVLLAILACLLGGLYLLGAFRRRRPGEPPLDKGPMPWLGHVLEFRRDTSKFLQRM
KKKHGDIFTVQLGGFYFTFIMDPLSFGAVVKESRGKLDFFKFAEQLVARVFGYMAMENEH
KHMQLSSNKHLMGDGLVVMTQAMMGNLQNLMLYSLGQGDNQKTWKEEALFNYCYNILFRA
GYLTLFGNEVACSSKSPEKAEELDRVTSNELFYKFQKYDKLFPDLAYGVLPPREKMEAER
LKRLFWDKFSVENVNKRENVSGWILEHQQFREENGVEKSMQDRFMFLLLWASQSNTGPTA
FWLLLYLMKHPEAMRAVQKEVEEVLRATEQTVKPGGPLINLTRDMLLQTPVLDGVVEETL
RLTTAPVLTRAVVEDMILKMADGREYKVRQGDRVSLFPYVAVHIDPDVHPDPLTFKYDRF
LTPEGTRKTDFYKNGKKVKYYSMPWGAGVSMCPGRFFATGEVKQFVFLMLSYFEFELTDP
EEKIPSINCRRWGFGSMHPTRNVQFRYRLRF
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgcacgttctgttgccagtccttcttgccatcttggcatgcttgcttgggggactgtac
ctcctgggggcctttcgcaggcgtcgccccggagagccgccgctggacaaagggcccatg
ccttggctcggacatgtgctggaattccggagggacacctccaagtttctccagaggatg
aaaaagaaacatggggacattttcactgtgcagctgggaggcttttacttcacattcatc
atggaccccctgtcctttggagcagtagttaaggagtccagaggaaaactggactttttc
aagtttgcagagcagctggtggcgagggtgtttggctacatggccatggagaatgaacat
aagcacatgcagctgtccagcaacaagcatctgatgggagacggcctggtggtcatgact
caggctatgatgggaaacctgcagaacttgatgctatacagcttgggccagggtgacaac
cagaagacctggaaggaagaggcactgttcaactactgctacaacattttgttccgggct
ggttacttgactctcttcggcaacgaggttgcttgctcctcaaaaagtccagagaaagct
gaagagcttgacagggtgacctccaatgagctcttctataagttccagaagtatgacaag
cttttccctgatttggcctatggggtcttacccccaagagagaagatggaagctgagagg
ctgaagaggttgttctgggacaaattttctgttgagaacgttaataaaagagagaacgtc
agtggatggattttggaacatcagcagttcagggaagagaatggagtggagaagtccatg
caggaccggttcatgttcctactgctctgggcctcacagagtaatacaggccctacagcc
ttctggcttcttctgtacctcatgaagcacccagaagctatgagagctgtccagaaggag
gtggaggaggtgctgagggccacagagcagacggtgaagccaggaggccccctcattaac
ctgactcgtgacatgctgctccagacccctgtccttgacggtgttgttgaggaaaccttg
agactgacaactgccccagttcttactagagccgttgtggaggacatgatcttgaagatg
gctgatggacgcgagtacaaagtccgccagggtgaccgcgtctcccttttcccctatgtc
gctgtccatattgacccagatgtccaccctgatccactcactttcaagtacgaccgcttc
ctcacaccagaagggaccaggaaaacagacttctataagaatggcaagaaggtgaagtac
tacagcatgccctggggtgccggggtgtccatgtgtccaggccgcttctttgccaccggt
gaggtgaagcagtttgtgtttctcatgctgtcatactttgagtttgagctgacggatcca
gaagagaagattccatcgattaattgcaggcgctgggggttcggatccatgcacccaaca
agaaatgtccagttcagatacaggttgaggttctaa

DBGET integrated database retrieval system