KEGG   Scleropages formosus (Asian bonytongue): 108919617Help
Entry
108919617         CDS       T04919                                 

Gene name
abhd12b
Definition
(RefSeq) protein ABHD12B
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sfm01002]
    108919617 (abhd12b)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sfm04147]
    108919617 (abhd12b)
Enzymes [BR:sfm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     108919617 (abhd12b)
Peptidases [BR:sfm01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   108919617 (abhd12b)
Exosome [BR:sfm04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   108919617 (abhd12b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Peptidase_S9 Abhydrolase_6 Peptidase_S15 Abhydrolase_2 Thioesterase LIP Abhydrolase_3 Lipase_3 Abhydrolase_8
Motif
Other DBs
NCBI-GeneID: 108919617
NCBI-ProteinID: XP_018583261
UniProt: A0A1W4Y4S2
Position
Unknown
AA seq 358 aa AA seqDB search
MKRRYNNRKPKNAGDSARKVELEKEEIKKCSSVVKNKWLLRVGTAFLALFIVYLSVPFVL
YCFPWIVGHLVYSHSFRIPFVDLSHPEDFSLNHTVNFYLTPEEGITVGVWQTVPDNQWQK
AQGKDLEWYKESLKDSTPVIIYLHGNMGTRALSHRVELIKVLSAAGFNVLTMDYRGYGDS
TGQPSEAGMTADAVYLYRWVKAYSGSSSVCLWGHSLGSGVATNAALKLQSDGFPVDCVIL
EAPFTNIYEEAAARNMVYWMFPGFENFIRYTLALNNLSFPNDENLKTLRSHLLLLHAEDD
NIVPFHMSQKLYHIAKDAKNKHVRMETYTQSLGYSHNGIYRDPQLSRKIWQFLQLLQK
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggagatataataaccgcaagccaaagaatgctggggattcagctcgaaaagtt
gagcttgaaaaggaggaaataaagaaatgttcgagcgtggttaaaaacaagtggctactg
agagtcggaacggcttttcttgcgctcttcatcgtctacctctccgtgccattcgtgctc
tactgcttcccttggatcgtgggtcatctcgtctattcccattccttcaggattcccttt
gtggatctcagtcatccagaggatttctcactaaatcacacagttaatttctatctcaca
ccagaggaaggtatcacagttggtgtgtggcagactgtcccagataaccagtggcaaaaa
gcacagggaaaagaccttgaatggtacaaggagtcccttaaagatagcacccctgtcatt
atctatctccatggcaacatggggaccagggcgctaagtcacagagttgagctcataaag
gtgttgagtgctgctgggttcaatgttcttactatggactacagaggttacggggattct
acagggcagcccagtgaggctggtatgactgcagacgctgtctacctgtatcgttgggta
aaagcatacagtggcagcagctcagtgtgtctctgggggcactcccttggctctggggtg
gccaccaacgctgcacttaaactacagagtgatgggtttcccgttgattgcgtgattctt
gaggctcccttcacaaatatttatgaggaggctgctgctcgcaatatggtttactggatg
tttccgggatttgaaaacttcatccgctatactttggctctgaacaatttgagcttccct
aatgatgaaaacttgaagacattaaggagccaccttctgctcttgcatgcagaggatgac
aatattgtacctttccacatgagtcagaagttgtaccatattgcaaaggacgccaagaac
aagcatgtcagaatggagacttacactcagtctttgggttactctcataatggcatctac
agggatcctcagttgtccagaaaaatctggcagtttctgcagctgctgcagaagtaa

DBGET integrated database retrieval system