KEGG   Scleropages formosus (Asian bonytongue): 108919646Help
Entry
108919646         CDS       T04919                                 

Gene name
akt1
Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm04010  MAPK signaling pathway
sfm04012  ErbB signaling pathway
sfm04068  FoxO signaling pathway
sfm04140  Autophagy - animal
sfm04150  mTOR signaling pathway
sfm04210  Apoptosis
sfm04218  Cellular senescence
sfm04261  Adrenergic signaling in cardiomyocytes
sfm04370  VEGF signaling pathway
sfm04371  Apelin signaling pathway
sfm04510  Focal adhesion
sfm04620  Toll-like receptor signaling pathway
sfm04625  C-type lectin receptor signaling pathway
sfm04910  Insulin signaling pathway
sfm04914  Progesterone-mediated oocyte maturation
sfm04920  Adipocytokine signaling pathway
sfm04933  AGE-RAGE signaling pathway in diabetic complications
sfm05168  Herpes simplex virus 1 infection
Module
sfm_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108919646 (akt1)
   04012 ErbB signaling pathway
    108919646 (akt1)
   04370 VEGF signaling pathway
    108919646 (akt1)
   04371 Apelin signaling pathway
    108919646 (akt1)
   04068 FoxO signaling pathway
    108919646 (akt1)
   04150 mTOR signaling pathway
    108919646 (akt1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108919646 (akt1)
  09143 Cell growth and death
   04210 Apoptosis
    108919646 (akt1)
   04218 Cellular senescence
    108919646 (akt1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108919646 (akt1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108919646 (akt1)
   04625 C-type lectin receptor signaling pathway
    108919646 (akt1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    108919646 (akt1)
   04920 Adipocytokine signaling pathway
    108919646 (akt1)
   04914 Progesterone-mediated oocyte maturation
    108919646 (akt1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108919646 (akt1)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    108919646 (akt1)
  09172 Infectious diseases: Viral
   05168 Herpes simplex virus 1 infection
    108919646 (akt1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sfm01001]
    108919646 (akt1)
Enzymes [BR:sfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108919646 (akt1)
Protein kinases [BR:sfm01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   108919646 (akt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 APH FTA2
Motif
Other DBs
NCBI-GeneID: 108919646
NCBI-ProteinID: XP_018583338
UniProt: A0A1W4Y568
Position
Unknown
AA seq 477 aa AA seqDB search
MQAIMTDVVIVKEGWLHKRGEYIKTWRPRYFLLKSDGTFIGYKERPQDVDQLETPLNNFS
VAQCQLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTKAIQTVADSLQRQEEE
MMDSSPDPMDVEVYLTKPRLKVTMHDFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKK
EVIVAKDEVAHTLTENRVLQNSKHPFLTGLKYSFQTHDRLCFVMEYANGGELFFHLSRDR
VFSEERARFYGAEIVSALDYLHSERNVVYRDLKLENLMLDKDGHIKITDFGLCKEGITDG
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGPDDAKEIMQHKFFAGIVWQDVYEKKLIP
PFKPQVTSETDTRYFDEEFTGQTITITPPGQDESMESFDSERRPHFPQFSYSASGTA
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccattatgactgacgtagtgattgtaaaggagggatggctgcacaaaagagga
gagtatatcaagacctggaggccaagatacttcttgctgaagagtgacggtacattcatt
ggatacaaggagagaccacaagatgtggaccagctggaaacgcctttgaataacttctct
gtagcccagtgccagctgatgaagacggagcgacccaggcccaacacattcatcatccgc
tgcctgcagtggaccactgtcattgaacgcaccttccacgtagagacccctgaggagagg
gaggaatggacaaaagccatccagaccgttgccgacagcctgcagaggcaggaggaggag
atgatggactcctcaccggaccccatggacgtggaggtgtacttgaccaaaccccgactc
aaagtgactatgcacgattttgaatacctcaagctcctgggaaaaggcactttcggcaaa
gtcatcctggtgaaggagaaggctacaggacgatactatgccatgaaaatcttgaaaaag
gaagtgatagtggcaaaagatgaagtagcacacacactcactgagaaccgagtgctacag
aactccaagcacccattcttgacgggattgaagtactccttccagacacatgaccggttg
tgttttgtcatggagtatgccaacggtggcgagcttttttttcacctctctcgtgaccgc
gtcttctcagaagagcgtgcccgtttctatggggcagaaattgtgtcagcgctggactat
ctgcactcggagcgtaatgtggtctacagagacctgaagctggaaaatcttatgctggac
aaggatggacatattaagatcacagactttggcctgtgcaaggaggggattacggatggg
gctaccatgaaaacgttctgtggaaccccagagtatctggcaccagaggtgctggaggac
aatgactatggccgggcagtggactggtggggcctgggtgtggtcatgtacgagatgatg
tgcggccgactgcccttttacaatcaggatcacgagaagctgtttgagctcatccttatg
gaggagatccgtttccctcgaaccctgggccctgaggctaagtctctgctctctggactg
ctgaagaaggatcccaaacagcggttaggaggagggccagatgatgccaaggagatcatg
cagcacaagttttttgcaggcattgtctggcaggatgtttatgagaagaagctgatccca
ccctttaagccccaggtcacctcggaaacggacacacggtatttcgatgaggagttcaca
gggcagacaattaccatcacgcccccaggacaagatgagagcatggagtctttcgacagc
gaaaggagaccccacttcccgcagttctcctattctgccagtgggacagcctaa

DBGET integrated database retrieval system