KEGG   Scleropages formosus (Asian bonytongue): 108919670
Entry
108919670         CDS       T04919                                 

Definition
(RefSeq) uncharacterized protein LOC108919670
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
sfm  Scleropages formosus (Asian bonytongue)
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sfm03000]
    108919670
Transcription factors [BR:sfm03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    108919670
SSDB
Motif
Pfam: PAS HLH PAS_9 PAS_3 PAS_4
Other DBs
NCBI-GeneID: 108919670
NCBI-ProteinID: XP_018583391
Position
16
AA seq 652 aa
MIPPGECLYAGRKRRKPVQKQKPMGATQKSNPSKRHRDRLNAELDRLAGLLPFSPEVISK
LDKLSVLRLSVSYLRVKSFFQAIQEKPARTHSTEPVSQEATKDALPDTSGIMESELLLES
LTGFALVVSTDGMIFYASSTIADYLGFHQTDVMHQNVFDYIHVEDRSEFQQQLHWAMKPE
LQCPNPDIHSPTVTGEDFSVSLFSPEKGDDIPVEFQCFLQRCFISRLRCLLDSTSGFLTM
QFQGRLKFLQGQRRKTTSGATLPPQLALFCVAAPVVKPIIAEVKSRATMIKSKQKNVTQS
VAEPSCERRHLNTGRMTDGGGVLLVNHTPWTLLSKDGIRCQSKGLYIKEEPLNFSESSDD
RQKGWGPEGPWALCPASGSIIVGPNLGHVRNRLGKCDHFVKGGTYQLSPSCCDNCCEPYL
PKVNPDMGCYHMDGIKKESGSLVEGECYGNHVVPNVPIKTEQDLDLDSSCGAYGGSHSQM
WMFKGPAEKHYDVCYDRGLQVKVESDYCNQYSSCQRHRTSLSSTFSGLFTNMDQRDQEPD
KCLSSKHLAQFSPEHYSHADGQGRNFMEGRIYRSSSLDEKGYMQQDYKLTYEFRSHGLVH
SIKREPMDSPPWTDSNHDINQVKCPKNKQELKIEEVDAWQIITREVQASGSH
NT seq 1959 nt   +upstreamnt  +downstreamnt
atgatccccccgggagagtgtctgtacgccggcaggaaacgacggaaacccgttcagaaa
cagaagcctatgggggcgactcaaaagtcgaatccatcaaagaggcatcgtgaccggctg
aacgcggagctggatcgtcttgccggccttctgcccttctccccagaagtcatctccaag
ctggacaagctttctgtgctgagactcagtgtcagctacctcagggtcaagagcttcttt
caagccatccaggagaaacctgccagaacacacagcactgagcctgtcagtcaggaggca
acaaaggatgctttgccagacaccagtggcattatggagagcgagctgttacttgagtca
ctgacaggtttcgccctggtggtgagcacagatgggatgatattctacgcctcatccacc
attgcggactacctgggcttccaccagacagatgtcatgcaccagaacgtgtttgattac
atccatgttgaggaccggagtgagttccagcagcagctacactgggcaatgaagcctgaa
ctgcagtgccccaacccagacatccactcacccacagtgactggtgaggacttttcagtc
agcctcttcagtcctgagaagggggatgacattccggtagagttccagtgcttcctgcaa
cgctgttttatctctcgcctgcgctgcctgctggacagcacatctggcttcctgaccatg
cagttccaaggccggctcaagttccttcagggccagagaagaaaaacaacatcaggtgcc
actcttccacctcagctggccctcttctgcgtagctgcacccgtagtgaaacccatcatt
gcggaggtcaagtcaagggctacaatgataaagagcaaacagaagaatgtcacccagtct
gttgctgagcccagctgtgagagaaggcacctgaacaccggaagaatgactgacggagga
ggtgtgttgctagttaaccacacaccctggacacttctatccaaggatggcatcagatgc
cagagcaaagggctctatatcaaggaggagcccttgaacttcagcgagtcttctgatgac
aggcagaaaggttggggcccagaaggcccgtgggcactgtgcccggcttcaggatccata
atagtgggtccaaatcttggccatgttcggaacagacttggcaagtgtgatcattttgtg
aaaggtggaacctatcagttgtcgccctcttgctgtgataactgctgtgagccttacctg
cctaaggtgaacccagatatgggatgttatcacatggatggcatcaaaaaagagagtggg
tccttagtcgaaggtgagtgctatggtaatcatgtggttccgaatgttcccatcaaaact
gaacaggatttggacttggacagcagctgtggtgcgtacgggggatcccacagtcagatg
tggatgttcaaaggacctgcggaaaaacactatgacgtgtgctatgaccgaggacttcag
gtgaaggtggagtcagattattgcaatcagtattcctcttgtcagcggcacagaacaagt
ctcagttctactttcagtgggctcttcacaaatatggaccagagggaccaggagccagat
aaatgcctttccagcaaacatctggcccagttcagccccgagcactattcccatgcagat
ggtcagggcagaaattttatggagggtcgcatttacaggagctcctctctagatgaaaaa
ggttacatgcaacaggactacaagttaacctatgagttcaggagtcatggcctggtccat
tcaatcaaacgtgagcctatggactcaccaccctggacagacagtaatcatgacattaac
caagtaaaatgccccaagaacaagcaagagctgaagattgaggaagtggatgcctggcag
atcatcaccagggaagtccaggcttcaggcagtcattga

DBGET integrated database retrieval system