KEGG   Scleropages formosus (Asian bonytongue): 108922036Help
Entry
108922036         CDS       T04919                                 

Gene name
qrsl1
Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00970  Aminoacyl-tRNA biosynthesis
sfm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    108922036 (qrsl1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sfm03029]
    108922036 (qrsl1)
Enzymes [BR:sfm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     108922036 (qrsl1)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     108922036 (qrsl1)
Mitochondrial biogenesis [BR:sfm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    108922036 (qrsl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 108922036
NCBI-ProteinID: XP_018587384
UniProt: A0A1W4Y6N9
Position
Unknown
AA seq 521 aa AA seqDB search
MLGLTIREVSQALRGGRVSPTELCTRCLEQVKRTGFLNAFVTVTEEQALRQASEAERRFL
EGKPRGPLDGIPFSVKDNFCTENIETTCASHMLKGYFPPYTATVVQKLLDQGAVLIGKTN
LDEFAMGAGSTDGVFGPVRNPWSYSAQYRERPGVDPRSDWVITGGSSGGSAAAVASLGSF
LALGSDSGGSTRNPGALCGLVALKPTYGLLSRHGLIPLVNSMDVPGILVRSADDAATALG
VLRGLDVRDSTTIPPPAAPPHLPDDIDIARIRVGIPKEYHAPGLSAETLCQWGRVADLLE
RGGASVEQVSLPHTQHSIVCYHVLCTAEVASNMARFDGLQYGHRSEVNDSTEALYAATCH
EGFNDVVRRRILAGNYFLLKRNYERYFMKAQKVRRLIAQDFARVFRDGVDVLLTPTTLGD
AVRYCDFIQEDNRTRSAQEDVFTQPVNMAGLPAVTVPTALSSRGLPISLQLIGRASHDWQ
LLGVAKWLEQRLEFPAIQLPQDVSQAEREAGVPGRVRTSVL
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctgggtttgacaataagagaagtgtcccaggccctgcgggggggccgcgtgtccccc
accgagctctgcaccaggtgcctggagcaggtgaagaggaccggcttcctcaacgccttc
gtcaccgtgaccgaggagcaggcgctgcggcaggcgagcgaggccgagaggcgcttcctc
gaagggaaacccaggggccctctggacggaatccccttctccgtgaaggacaacttctgc
acggagaacatagagaccacgtgcgcctctcacatgctgaaaggctatttccctccctac
acggcaacggtggttcagaagctcttggaccagggtgctgttctcatcggcaagaccaat
ttagatgaatttgcgatgggggcgggcagcaccgacggcgtgttcggcccggtccggaac
ccctggagctactcggctcagtaccgcgagcgacccggcgtggacccgcgctcggactgg
gtgatcactggcgggagctcgggaggaagtgcggcggctgtggcctccctcggcagcttc
ctcgccctgggatcggacagcggaggctccacgcggaacccgggggccctttgcgggttg
gtggccctcaaacccacctatggccttctgtcccgccatggcctcatccctctggtgaac
tcgatggacgtgccagggatcctggtccgaagtgctgatgacgccgccaccgccttgggg
gtcctccggggtctcgacgtcagggactccacgacgatcccccctcccgccgcacccccg
cacttgcccgatgacatcgatatcgcaagaatccgcgtgggcatcccgaaggagtaccat
gccccgggtctgtccgcggagacgctgtgccagtgggggcgcgtggccgacctgctcgag
agggggggagcgtccgtggagcaggtgtccctccctcacacccagcactccatcgtgtgc
taccatgtgctgtgtacggcggaggtggcctccaacatggcgcggttcgacggcctccaa
tatggccaccgcagtgaggtcaacgactcgaccgaggctctgtacgcagcaacgtgccac
gaaggcttcaacgatgtggtcaggcggaggatcttggcaggaaactattttctgctgaag
cgcaactacgagcgctactttatgaaggcccagaaggtgcgccgactgatcgcgcaggac
ttcgcgcgggtgtttcgcgacggggtggacgtgctgctcacccccaccaccctgggagac
gccgtgcgttactgcgatttcatccaggaggacaaccggacccgcagcgcacaggaggac
gtcttcacacagcccgtcaacatggcaggcctccccgccgtcaccgtgccgacggcactg
tcgagcagaggcctccccatcagcctgcagctgattggccgagcctcgcatgactggcag
cttctgggcgtggccaagtggctggagcaacgcctggagttcccagccatccagctgccc
caggatgtgagccaagcggagcgagaggccggcgtccccggcagggtgcggacatcggtg
ctgtga

DBGET integrated database retrieval system