KEGG   Scleropages formosus (Asian bonytongue): 108922168
Entry
108922168         CDS       T04919                                 

Gene name
mecom
Definition
(RefSeq) histone-lysine N-methyltransferase MECOM isoform X1
  KO
K04462  ecotropic virus integration site 1 protein
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108922168 (mecom)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sfm03000]
    108922168 (mecom)
Transcription factors [BR:sfm03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    108922168 (mecom)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_6 zf-H2C2_5 zf-C2H2_jaz zf-C2H2_8 zf-BED Zn-ribbon_8 PyrI_C zf-C2H2_11
Other DBs
NCBI-GeneID: 108922168
NCBI-ProteinID: XP_029111454
Position
10
AA seq 1046 aa
MKAEEYSYEAMAPDIHEERQYRCQDCDQHFESRTELQDHRKQPCGTPHSAFSLANPEDSP
HSAQECKDCDQVFPDTQSLETHALAHSEEREYKCDQCPKAFNWKSNLIRHQMSHDSGKHY
ECENCSKQVFTDPSNLQRHIRSQHVGARAHACPDCGKTFATSSGLKQHKHIHSSVKPFIC
KSLRPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCEGK
NHFAAGGLFGQGIAIPGTPSLDKAGIDGMGHGSPGLTDYFGANRHHSGLTFPTAPTFPFS
FPGLFPSGLYHRPALIPTTSPMKGPAGSEHPTKSPLLDSLQRTHGARDLLKVLDKESSLK
EPQVPERHTQASSEHRRVGKLSDQSESSDLDDVSTPSGSDLESTSGSELESDLESDRERT
RENGKVAKRKSGSPQGLPLVNSSAKDFGSSGLFQPTLDEHTAVSGAVNDSIKAIASIAEK
YFGSTGLAGLQDKKVGALPYPSMFPLPFFPAFSPPLYPFPERDLPPSTLKGEPESPPAEA
KKGQIRNSESPFDLTTKRKEEKMSPFASSKPDASHVSSQDQPLDLSMGSRNRSGSGKAED
SRKNHMFREEKSSETEPPKADSSLQHARPTPFFMDPIYSRVEKRKINDPFEALKDKYMRP
APGFLFHPQFRVPDQRTWMSAIENMAEKLETFGSLKPDAGDLMRSVPSMFDFRAPPSAIP
DSLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHIRN
IHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNLSGTAMSSPRSELDSSSAILDDKEDS
YFNEIRNFISNTGQSQASPEPSEEGLNGNRFEDEKPLPSQGSHDLEEEEGEELGVNEEEG
QHNDSVGKSRDEPLPGNMDDDIIHSEAEFEEANDSNLNCKGFPRRYEDDEEQSSFSALEH
IRHLSDIRKMEESEFSDSDASFAASHLSEAINPPLYRKSKSQAYAMMLSLADKEALHAAT
HTPANVWHTLARAAAESSAIQSLSHV
NT seq 3141 nt   +upstreamnt  +downstreamnt
atgaaggcggaggagtattcgtatgaggccatggcacctgacatccacgaagaacggcag
taccggtgccaagactgcgaccagcactttgagtcgaggacagagctgcaggaccaccgg
aagcagccgtgtggtacccctcattctgctttttctctggcgaacccggaggacagtccc
cacagtgcccaggagtgcaaggactgcgaccaagtgttcccggacactcagagcctggag
acacacgccctggcacactcggaggagcgcgagtacaagtgtgaccaatgtccgaaagcg
tttaactggaagtccaatctgattcgccaccagatgtcacacgacagtggcaagcactac
gaatgtgaaaactgctcaaagcaggtgttcacggaccccagtaacctgcagagacacatc
cgttcgcagcacgtaggggcccgtgcgcatgcctgccccgactgtggcaagaccttcgcc
acatcctcgggcctcaagcagcacaagcacatccacagcagtgtcaagcccttcatatgt
aagtcactcagacccttcatatgtgaggtgtgtcacaagtcctacacgcagttctccaac
ctgtgccgccataagcgcatgcatgctgactgccgcacgcagatcaagtgtaaggactgc
ggccagatgttcagcaccacatcgtcgcttaataagcaccgccgcttctgtgaggggaag
aaccattttgccgcgggaggactgtttggccagggtattgctatcccagggacaccgtcg
ttagacaaggcaggaatagatggcatgggccacggcagccccggactcacagactacttt
ggggccaacaggcaccacagcggactgaccttccccacggcacccacgttccccttcagc
tttcctggactattcccctccggactgtatcacagacctgcgctcattcccaccacctcc
ccgatgaaaggtcccgccggttcagagcatccgaccaagagcccgcttctggactccctg
caacgaacccatggtgctcgggacctgctgaaagtcctagataaagagtcatctctcaag
gagccccaggttccagagcgccacacacaggcctcctctgagcacagacgtgtgggtaaa
ctgagcgaccagtcagaaagcagcgaccttgatgacgtgagcactccgagcggcagtgac
ctggagagcacttctggatcggagctcgagagcgacctggagagcgaccgggagaggact
agggagaacggcaaagtggccaagagaaagtccggaagccctcagggcctgcccttagtc
aacagcagtgccaaggactttggtagcagtggtctgtttcagcccacgctggacgaacac
acggctgtgtccggggcagtcaacgactccatcaaggccattgcttccattgccgaaaaa
tattttggctctacgggactcgccggcctgcaggacaaaaaggtgggtgcactgccgtac
ccatccatgttcccccttcccttcttcccagccttttcgccacctctctacccctttcct
gaaagagacctgcctccatccaccttgaaaggggagcccgagtctcccccagctgaggcc
aagaagggccaaatcaggaattccgagtcgcccttcgatctcaccaccaagcgcaaagag
gagaaaatgtccccatttgcgtcctcaaaaccggacgcgtcgcacgtctccagtcaggac
cagcctctggacctgagcatgggctccaggaatcgcagtggcagtggcaaggcagaggat
tccagaaagaaccacatgttcagggaggagaagtcatctgagaccgagccacccaaagca
gactcctcacttcagcacgctcgtccaacacctttcttcatggaccccatctacagcagg
gttgagaaaaggaagatcaatgatccgtttgaagcgctgaaggacaagtacatgcgacca
gcccctggctttctcttccacccacagtttcgtgtgccagatcagcggacgtggatgtca
gccatagaaaacatggccgagaaactggagacgttcggctcactcaagccggacgccggc
gacctcatgcgcagcgtcccgtccatgttcgacttcagggcgcccccgagcgccatcccc
gacagcctgctgcgcaagggcaaggagcgctacacctgcaggtactgtgggaaaatattc
ccacggtcggccaacctgacacgtcacctgaggacacacacgggagagcagccctacagg
tgcaaatactgcgaccgctccttcagcatctcctcgaacctgcagcgccacatccgcaac
atccacaacaaggagaagcccttcaagtgtcacctgtgcgaccgctgtttcggccaacag
acgaacctcgaccgacacttgaagaaacacgagaatgggaacctctcaggcacggccatg
tcatccccgcggtcggagctggacagtagcagcgctatcctggacgacaaagaggactct
tacttcaacgaaatacgaaacttcatcagcaacacgggccagagccaggcgtcccccgag
ccttcggaggaagggttgaacggcaatcggttcgaggacgagaagcctctgcccagccag
gggtcgcatgacctggaggaagaggaaggagaggagctgggcgtcaacgaagaggaaggg
caacataatgattctgtggggaagtccagggatgagcccctccctggcaacatggacgat
gacatcattcacagcgaggccgagtttgaagaagcgaatgacagcaacctcaattgcaag
ggcttccccaggagatatgaggatgacgaggagcagagcagcttctctgcactggaacac
attcgacacctttctgacattcgcaagatggaggagagcgagttcagtgacagcgacgcc
agctttgccgccagccacctttccgaggctattaacccaccactttacaggaagtccaag
tcccaggcttatgccatgatgctctcactggcggacaaggaggctctccatgcggccacc
cacaccccagccaacgtgtggcataccctggctcgggctgctgctgagtccagcgccatc
cagtccctcagccacgtatga

DBGET integrated database retrieval system