KEGG   Scleropages formosus (Asian bonytongue): 108922504Help
Entry
108922504         CDS       T04919                                 

Definition
(RefSeq) probable low-specificity L-threonine aldolase 2
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00260  Glycine, serine and threonine metabolism
sfm01100  Metabolic pathways
sfm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    108922504
Enzymes [BR:sfm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     108922504
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 108922504
NCBI-ProteinID: XP_018588213
Position
3
AA seq 424 aa AA seqDB search
MAMFAKAVRTRALLRSATLDMIGAARRGLATAAAGVERARAPAAHREPGGPLRVRTVDLR
SDTVTKPGAAMRRAMAEAHVGDDVFGEDPTVNELQKRAADLFGMEAALFVPSGTMSNLIA
VMVHCSERGDEMIVGDLAHLHVYEQGGSAQLAGVHATTVATRSDGTFDLHELEDKIRHGY
PDPHYPRSRLVCVENTHNILGGRVLPLSFLQELRALADRYGLAVHMDGARLMNAAVNLGV
SPPVILQHCHTVSVCLSKGLGAPVGTMLAGPKDFVQKAVRARKALGGGLRQSGILAAAGM
LALTDMVDRLKEDHRRARTFAQALKQCDPPMYEVDMAAVETNILRFRLSSPCLSPAEFCV
RAEAVCEDEARVLGQGVRVLMFPHVGGTIRAVWHLGISDDDNQAAAEKLHFLAQQLTKQR
VRPN
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgtttgcgaaggctgttcggacaagggccctgctgcgctccgcgacactcgac
atgattggtgctgcgcgccgtgggctcgcgacggccgccgccggagtggagcgcgcgcgc
gctccggccgcgcacagagagcccggcgggccgctccgggtccggactgtggacctccgc
agtgacacggtgacaaagcccggagcagcgatgcgtcgagccatggccgaagcacatgtg
ggagacgatgtgttcggagaggaccccacggtgaacgaactccagaagcgagcagcggac
cttttcggcatggaagcagcgctgtttgtgccctctgggaccatgagtaacctcattgct
gtcatggtccactgctcagagcgaggagacgagatgatcgtgggggacctcgcccacctg
cacgtctatgagcagggaggcagtgcacagctggctggtgtccacgccactactgtagcc
accaggtctgatgggacctttgacctccatgagctagaggataagatccgtcatggctac
ccagatccccactatccccgctcccgcctggtgtgtgtggaaaacacccacaacattctt
ggaggccgggtcctgcctctctccttcctccaagagctgcgcgctctggcagaccgctat
ggcctggcagtccacatggatggggccaggctcatgaatgctgctgtgaacctgggtgtg
tctccacctgtcattttgcagcactgtcacactgtcagtgtgtgcttgtccaaggggcta
ggtgcaccggtggggaccatgcttgcggggccaaaggactttgtgcagaaggcagtgcgt
gcccgaaaggccctgggtgggggactgcgccagtcaggcatcctggctgcggcgggaatg
ttagcactgacagacatggtggaccggctgaaggaagatcatcggcgtgctagaacattt
gcacaggcactgaagcagtgtgacccccctatgtacgaagtggacatggctgccgtggag
accaacatcctgcgctttcgtctaagcagcccatgcctgagcccggctgaattctgtgtg
cgtgctgaggctgtatgtgaggatgaggccagagtgctggggcagggagtgcgggtcctc
atgttcccacatgtcgggggcaccatcagggcagtatggcacctgggcatcagtgatgat
gataaccaagctgctgctgagaagctgcacttcctggctcagcagcttacaaagcagaga
gtcaggcccaattaa

DBGET integrated database retrieval system