KEGG   Scleropages formosus (Asian bonytongue): 108922850
Entry
108922850         CDS       T04919                                 

Gene name
apln
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm04080  Neuroactive ligand-receptor interaction
sfm04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108922850 (apln)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108922850 (apln)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 108922850
NCBI-ProteinID: XP_018588762
Position
13
AA seq 76 aa
MNVKILTLVIVLLLSLLCSGGAGPMASAGHGKEVEESHIRRLAQQNPARSAQSHRPAGWR
RRRPRPRLSHKGPMPF
NT seq 231 nt   +upstreamnt  +downstreamnt
atgaatgtgaagatcctgacgctggtgattgtgctgctgctgtctctcctgtgttccggc
ggtgctggacccatggcctctgcagggcatggaaaggaggtggaggaaagtcacataaga
aggttggctcagcaaaatcctgcaaggagcgcccagagccacagacctgccggctggagg
aggcgacgtccacggccccgcctttctcacaaggggcctatgccattctag

DBGET integrated database retrieval system