KEGG   Scleropages formosus (Asian bonytongue): 108923000Help
Entry
108923000         CDS       T04919                                 

Definition
(RefSeq) retinal guanylyl cyclase 2-like
  KO
K12321  guanylate cyclase 2D/E [EC:4.6.1.2]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00230  Purine metabolism
sfm01100  Metabolic pathways
sfm04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    108923000
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    108923000
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sfm01001]
    108923000
Enzymes [BR:sfm01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     108923000
Protein kinases [BR:sfm01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   108923000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase HNOBA Kinase-like DUF3482
Motif
Other DBs
NCBI-GeneID: 108923000
NCBI-ProteinID: XP_029113016
Position
13
AA seq 1256 aa AA seqDB search
MANESTRGHFETPGTLWASFVPISPKSLSQKANIKRVVCLLALDGRLLEDYCTTNAADPS
PGPNSEVSGVPDSAVAPTCPLCRRTPPSPGQEASDPRSVLCSPTVRALFPVHPAHRSKAM
AVHAIRADSACLYSLSHHPRWRGSSQGRPRASVSTRLTAASAPPLTVCCRAQRLWHPLLV
TLALVCLPSRAWATTFKIAVVGPWTCDPLFSKALPDVAARLATSRINKDPHLSKGYWYDY
SLVSEDCQSSRALARFAELEGYGSAFLGPANPGYCSSAALLAKNWNKGLLSWACLEPAAD
KSSYPTFLRPLPLSSRVLFSVLRFFRWAHVAVVSTKDDLWEATGDELASSLRALGLPVSA
AVTMETGEDGPRKALKTVRELDRVKVVIMCMHSVLIGGKAQRDLLTTALDMRMVDRGYVF
IPYDTLLYALPYKDASYPVLANDTKLRRAYDAVLTVTMDSGERNFYEAFRDAQERYEIRT
STPAEQASARGWGVSPFFGTIYNMLYFLAMSVEQVRVAGGRWVTGEALARSPGDFEFAGF
NQPLRSGRNGEGMQGRYVVLDTDGRGSSLRSTHALEAAHTYGDIGGLKYYGRAIHFPGSS
PSSDATCWFSPNTACSGGVDGTALFLMFILSCFLAAGVVLFRAKFAQLWSMLGGGGEGAS
KLVLTLEDLVFINTQLSRRKLNEESIIKSILYVKTSSHSVSGHSYIYTSPESSNVAVFEG
DWVWLKKCPNGDKVVEVNRSTKVIFNKLRDMRQENLNLYLSLFLDCGIFAIVTEHCTRGS
LQDLLNNEDMRLDWMFKSSLIMDLIRGMKYLHNHNVIHGRLKSRNCVVDGRFVLKVTEYG
YNGIMDCQKMIMEPQKPEDQLWTAPELLRNPALERKGTFKGDVFSFSIILQEVITRNSPF
CMLDMPAEEIIQKLRSPPPLCRPTVSMEKAPLECLQIMKQCWSEEPERRPTFEEIFHQFR
NVNKGKKTNIIDSMLRMLEQYSSNLEDLIRERTEELEVERQKTDRLLAQMLPRSVAHALK
TGKPVEPEHFAEATLYFSDIVGFTTISALSEPIEVVDLLNDLYTLFDAIIGEHDVYKVET
IGDAYMVSSGVPNRNGNRHAAEVSNMSLDILHCIGAFKMRHMPDVKVRIRIGLHSGPVVA
GVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNQSTVDILNKLKLGYKMDLRGKTELK
GKGVEDTYWLVGRDGFDKPLPVPPDLTPGASNHGISLDEIPADRRQKFLERQKRMQ
NT seq 3771 nt NT seq  +upstreamnt  +downstreamnt
atggccaatgaaagcactagaggacactttgagacacctgggacactttgggcttcattc
gtgccgatctctcctaaaagcctgtcgcagaaggcaaacatcaagcgtgtggtctgcctg
ttggccctcgatggccggctattagaagattattgtaccactaatgccgctgatccatct
ccaggacctaattctgaggtcagcggtgtccccgattctgccgtcgccccgacatgcccg
ctgtgccggaggactccgcccagccccggtcaggaggcctctgatccccgctccgtcctc
tgctcccccacggttcgagcgctattcccggtccacccggctcatcgcagtaaagccatg
gccgtccacgccatccgcgccgactccgcgtgtctctacagcctctcccatcacccacgg
tggcgcggctcttcccaggggcgcccaagggcgagcgtctccacgcggctcacggctgct
tccgctccgcctctgaccgtctgctgccgggcccagcgcctctggcatcccctgctggtg
acgctggcgctggtctgcctgccgagccgggcctgggccaccacgttcaagatagccgtt
gtggggccttggacgtgtgaccctctcttctccaaggcgctgcccgacgtggcggcccgc
ctggccaccagccgcatcaacaaggacccccacctgagcaagggctactggtacgattac
agcctcgtgtccgaggactgccagagctccagggcactggcgcgcttcgccgagctcgag
ggctacggctcggccttcttgggacccgccaacccgggctactgctcatccgccgccctg
ctggccaagaactggaacaagggcctcctgtcgtgggcgtgcctggagccggctgccgac
aagagctcgtacccgacgttcctgcgcccactgcccttgtcgtctcgcgtgctcttctct
gtgctgcgcttcttccgctgggcgcacgtggccgtcgtcagcaccaaggacgacttgtgg
gaggccacaggggacgagctggcgtcctcgctgcgtgccctcggcctgcctgttagcgcc
gcggttaccatggagaccggggaggacggcccgcgtaaggccctgaagaccgtccgggag
ctggaccgggtcaaagtggtcatcatgtgtatgcactcggtgctgattggcggaaaggct
cagcgggacctgctgaccacagccctggacatgcgcatggtggaccgcggctacgtgttc
atcccctacgacacgttgctctacgccctgccctacaaggacgcctcgtacccggtgctg
gccaacgacaccaagctgcgcagggcctacgacgcggtgctcactgtcaccatggactct
ggagagcgcaacttctacgaggcttttcgagacgcccaggagagatacgagatccgcaca
agcaccccagcggagcaggcgagtgcacggggttggggggtgtcgccgttcttcggcacc
atctacaacatgctctacttcctggccatgtcggtggagcaggtgcgggtcgcgggcggc
cgctgggtgacgggggaggcgctcgcccgcagcccgggcgactttgagttcgccggcttc
aaccagccgctgcggtccggcaggaacggggagggcatgcagggccgctacgtggtgctc
gacacggacggccgtggctcctccctgcggtccacccacgcgctggaggcggcgcacacc
tacggcgacatcggggggctcaagtactacggccgtgccatccacttcccagggagctcg
cccagcagcgacgccacctgctggttcagccccaacacggcctgcagcgggggtgttgac
ggaaccgcgcttttcctcatgttcatcctgagctgcttcctggctgccggagtcgtgctc
ttcagagcaaagttcgcacagctgtggtccatgctaggcggtggaggcgaaggagcctct
aaactggtgctgaccctcgaagacctggtcttcatcaacacacagctcagcaggcggaaa
ctcaacgaggaaagtataataaagagtattttgtacgtgaagacctcatctcattccgtg
tcaggacacagctacatctacacgtcccccgagagctccaacgtggccgtgtttgagggt
gactgggtgtggctcaagaagtgtcccaatggagacaaggtggtcgaggtgaacagaagc
accaaagtgatcttcaacaagctccgtgacatgcgccaggagaacctgaacctgtacctg
agcctctttctggactgcggcatctttgccatagtgacggagcactgcactcgtggcagt
ctgcaggacctgctcaacaacgaggacatgcgcctcgactggatgttcaaatcttctctc
atcatggatcttatccgaggaatgaagtaccttcacaatcacaacgtcatccacggacgc
ctcaagtcccgcaactgcgtagtggacggacgctttgtgctcaaggttacggagtacggc
tacaacggtatcatggactgtcagaaaatgatcatggagccccagaagcctgaggatcag
ctgtggacggcccctgagctgctgaggaatcccgcgctggagaggaagggaaccttcaag
ggcgacgtgttcagcttctccatcattctgcaggaggtcatcacacgaaacagtcccttc
tgcatgctcgacatgccagcagaggagatcatccagaagctgcggtcaccaccgccactg
tgcaggcccacggtctccatggagaaagcgccgctcgagtgcctccagatcatgaagcag
tgctggagtgaggagcccgagaggaggcccaccttcgaggagatcttccatcagttcagg
aacgtgaacaaggggaagaagaccaacatcatcgactccatgctgcggatgttggagcag
tactccagcaacttggaggacctgatcagagagcgcaccgaggagctcgaggtggagaga
cagaagacggaccgcctgctggcgcagatgcttcccaggtcggtggctcacgccctcaag
acaggcaagccggtggagccggagcacttcgccgaggccacgctgtacttcagcgacatc
gttggcttcaccaccatctcagcgcttagtgaacccatcgaggtggtggacctgctcaac
gacctctacacgctctttgatgccatcattggagaacatgacgtgtataaggtggagacc
atcggtgatgcctatatggtgtcctcaggggtcccgaaccgcaacggtaaccggcacgca
gctgaggtgtccaacatgtctctggacatcctgcactgcatcggggccttcaagatgagg
cacatgcctgacgtgaaggtcaggatccgcattggcctgcactccggtccggtagtggcg
ggagtggtggggctcaccatgcctcgctactgtctcttcggagacaccgtcaacacagcc
tcccgaatggagtccacgggcttgccttacaggatccatgtgaaccagagcaccgttgac
atcctgaacaagctcaagctcggatataagatggatttacgagggaagacggagctgaag
gggaaaggagttgaagacacgtactggttggtggggagagacgggttcgacaaaccactg
cctgtgccacccgatctgaccccaggagccagcaaccacggcatcagtctggacgagatc
cctgccgaccgcagacagaagttcctcgagcggcagaaaagaatgcagtga

DBGET integrated database retrieval system