KEGG   Scleropages formosus (Asian bonytongue): 108923540Help
Entry
108923540         CDS       T04919                                 

Gene name
thnsl2
Definition
(RefSeq) threonine synthase-like 2 isoform X1
  KO
K06037  O-phospho-L-threonine phospho-lyase [EC:4.2.3.-]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    108923540 (thnsl2)
Enzymes [BR:sfm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.-  
     108923540 (thnsl2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP PspA_IM30
Motif
Other DBs
NCBI-GeneID: 108923540
NCBI-ProteinID: XP_018589855
Position
5
AA seq 484 aa AA seqDB search
MRYCSTRGGVQGWGFQQVLFSGYAPDGGMFMPEALPALSPDTLKLWTSMSYPELVLELCS
LFIPHDVIPHDDLKDLLSQALYHFSVPGAVRLVRLEGGLCLLELFHGETLAFKDLAMRCT
AHLLQYFLRKENRRAVVLVGTSGDTGGSAIRSVCGLQGLDVVVVFPRGRITSIQERQMTT
SLEDNVHVFAADGSSDDIDVPLRRLFADQDLVKRHGLMSLNSVNWVRILVQLAHFLYAYL
QLSGIEQVKGHVLPSLEVVVPTGGAGNIAAGCILKQMGVPLRLVAMVNRNDTVHRAVESG
DFSMADSVKKTLASAIDIQDPYNMERVFWLLSGGDSALVKRLMEEFQDSHRTVLPGALHK
KLSSVLSAGSVTDEGIVETMQKCWQDSRYLLCPHTAVAVWHHYHCPLRPGESRCCIATAS
PVKFQEAVHRAGLTLELPEGMQRLKKMRTRCAKLEEGMDWESQLRERIEHIRSVRERGEL
YYSA
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgcgctattgcagcacaaggggaggcgtgcagggctggggcttccagcaggttctgttt
tccggctatgctccagatggggggatgtttatgccagaggccttgccagccctctctcct
gacaccctcaagttgtggacctctatgtcctaccctgagctcgttctcgaattgtgctcc
ttgttcatccctcatgatgttatccctcacgatgatctaaaagatttgctgtcgcaggcc
ttatatcacttctcggtgccaggtgctgtacgtctggtgcgactagaagggggactctgt
ctgctggagctctttcatggggagactctggctttcaaggacctggccatgaggtgtacg
gctcacttgttacaatacttcttgcgtaaagaaaacaggcgagccgttgttcttgtagga
acttcaggggacacaggtggctctgctatccgtagtgtttgtggactgcaggggcttgat
gtagtggtggtattccctcggggccgcatcacatctatacaggagagacaaatgacaacc
agtttggaagataatgttcatgtctttgcagcggatgggagctctgatgatattgatgtc
ccactgcgtcgtctcttcgcggatcaggacctggtgaagcgtcatggactgatgagtctc
aattctgttaactgggtccgaatcctggtgcagcttgcccatttcctgtatgcatacctc
caactgagtggcattgaacaagtcaagggtcacgtgctgcccagcctcgaggtggtggtg
cccacaggtggtgctggtaatattgcagctggctgcattttgaaacagatgggtgtacct
ctgcgcctggttgccatggtaaatcgcaatgacactgtgcaccgtgcggtagaaagtggt
gacttctctatggctgacagcgtcaagaagaccctggcctctgccatagatattcaggac
ccctacaacatggagcgggtcttctggctgctgtctgggggagactctgcactggtcaaa
aggctcatggaagaatttcaggattctcacaggactgtcttgccaggtgcactccataaa
aagttgtcctcagtactgtctgcaggatcagtgacagatgaagggatagttgaaactatg
cagaagtgctggcaggacagcagatacctgctatgtcctcacactgctgtcgcagtttgg
catcactaccactgtcccctacgccctggggaaagcaggtgttgcatagcaactgcatcc
cccgtcaaatttcaagaagcggtacacagggcaggacttaccctcgaactgccggaagga
atgcaacgtcttaagaaaatgagaacacgctgtgcaaagctggaagaaggcatggactgg
gagtcccaactgagagaacgcatagagcacattcgttctgtccgagaacgcggagaatta
tattacagtgcttaa

DBGET integrated database retrieval system