KEGG   Scleropages formosus (Asian bonytongue): 108924238Help
Entry
108924238         CDS       T04919                                 

Definition
(RefSeq) titin-like
  KO
K12567  titin [EC:2.7.11.1]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sfm01001]
    108924238
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sfm04131]
    108924238
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sfm04812]
    108924238
   04147 Exosome [BR:sfm04147]
    108924238
Enzymes [BR:sfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108924238
Protein kinases [BR:sfm01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   108924238
Membrane trafficking [BR:sfm04131]
 Others
  Actin-binding proteins
   Others
    108924238
Cytoskeleton proteins [BR:sfm04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     108924238
Exosome [BR:sfm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108924238
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set fn3 Ig_3 Ig_2 ig V-set Pur_ac_phosph_N fn3_2 C2-set_2 Receptor_2B4 Pkinase Tissue_fac Ig_6 C1-set Pkinase_Tyr Ig_5 Titin_Z THB Izumo-Ig Ig_4
Motif
Other DBs
NCBI-GeneID: 108924238
NCBI-ProteinID: XP_029103317
Position
21
AA seq 31419 aa AA seqDB search
MTTQAPTFTQPLQSVAALEGSAAKFVAEVSGVPVPEVSWFRDGQVLSAAALPGIQISFSE
GRAVLMIPAVTAAHSGRFSVRATNGAGQATSTAELLVTAETAPPNFIQRLQSMTVRQGSR
VRLDVRVTGIPTPVVKFYREGAEIQSSADFQILHEGDRYSLLIAEAFPEDSGTYSVSATN
SSGRATSTAELLIQGEEVAVPAKKTKTILCTAQTSQTRQARVENREEAHYQVAAAMMEIH
VEEGAVAEHLRHKTPPLVRTKPTSKSPTSTLVSKVAGTRQQSPSPVRHVKAPTPTPVRSV
SPSTRLSVSPIRPVKSPVMTRKQPTPSTDVLPPWKQEDYVAESDMIVCVQSSATRIQMEQ
RFEGSYGAQQQGQHEDGKMIAVATVVAAVDQARGREPCSDSREWSSTERSIDTMQLYPEK
EQAEGGKKAEAVATVLAAVDLARIRKPAQAEGVRTEEEIVERDLKQQALTKQISKQQVTT
VTMKTEAVQTPPPIVLAEDSVSVSQIKRSKETPIHVDPALAPSPSPHFTVSKVTVPKHDH
SYEVSIAGSAIATLQKELSSTTASQKIIRPVKPPSHKIVETRVMSEPVLPPFRDTSERYQ
ASFTTSMQKGIGLSFTGGMEQTHVQLEKEVVEAAAVPSPAQEAVVPPTLVVGLKNVTVTE
GESVTLECQISGHPAPSIMWFREDYRIESSIDFQITYENGYARLVIREAFAEDSGRFTCT
ATSEAGTVSTSCYLLVKVSEEIESREEIITAVSAHMETVEEKRISTEVKEEILEVPASAE
AVAPFFVRKPTVQKLVEGGSVIFECQIGGSPKPHIYWKKAGVPLTTGYRYRVTYNKETGE
CKLEISMTFADDAGEYSICARNQLGEVSASASLLEEEEYEAYMKMHEMTIMTEGIIMVQE
PRVADVPPVVMTEYEREQILMQKRMTQQTQMLKTFVTEQEFQISAFEERIIREIELRILK
ITYQVLVTEDGEEMVMSVAEHEAVEPVFDTPVKNYRILEGMGVTFHCKVSGNPLPKIAWY
KDGKRIIHGGRYQMEVLQDGRASLRIPVLLPEDEGVYTAFATNMKANAVSSGKLYVEPTT
VVGAQPYFPQPEAIRIRRSTSPRSASYSPGRSPGRSPARRLDETDESQLEKLYKPVFVMK
PFSFKCLEGKTARFDLKVVGRPMPETFWFHKGQQIVNDYTHKIVVKEDGTQSLIVVPAMP
YDSGEWTVVAQNRAGKASVSVTLTVDAKEDLVRPQFIEKLKNISVKEGTLVELAVKAIGN
PLPEIVWLKNSDIISPQKHPHIRIEGAKGVAHFKIASTTSSDSAWYTATAVNKAGRDTTR
CRVNVEVEFAEPEPERKLIIPKGTYKAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQK
PHFKKKLTSVRLKRFGPVHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSL
DYEVAYARDSGVVTCRATNKYGVDQTSATLIVKDEKGLVEETQLPEGRKGMQRIEEMERL
AHEGALAGVTAEEISEKTKPEIVLVPEPARVLEGETARFRCRVTGYPTPKVNWYLNGQLI
RKSKRFRLRYDGIYYLEITDSKSYDSGEIKVVAENPEGVSEHCVKLEIQQREDFRSILRR
APELKAPESGTSPDRGRVSFEVQKVDKPVDTTQPKEIIKLRKAERVVHEKSTEETEELRS
KFKRRTEEGYYEAITAVEFKSCKRDDSYEELLKKTKEELLHWTKDVPEEEKKKEEERGKV
TIPKIKPERVELSPSMEAPKIMERIQSQTVSQTDEVRFRVRVVGKPDPECQWFKNGVLLE
KSDRIYWYWPEDNVCELVIRDVSAEDSASIMVKAINIAGEASSHAFLLVQAKQAVVFTQE
LEDIIAKEKDTMVTFECETSEPFVKVKWLKNNMEIFSGDKYRMHSDRKVHFLSVLMIEMK
DIAEYTCCVVEDDHIRTTAKLTVEGAPLDILTALENIEVPETYSGEFECEVSREDAEGTW
YFEGKEITPSSKYVMSSRRGRHSLCVRDVKKEDQGKYSFVVGDLKTAASLTMKLRPVTLM
QGLSDLSVCEGDIVQLEVKFSQENVEGIWMRSGQAILATDRIHIVIDKLVHKLLIEDAQR
SDAGMYSFFVPAQDITSSAKLTVQSIGILTPLKDVTSVEGTKAVLEAKISAADISSVKWY
HNDKLIVPSERVQFVAKGSKQRLVFSRTFASDEGCYKLVVGKAETSCNLTIEKIEILKQM
EDQMCTETQNVTFEVDLSHSGIDAVWTFKNQTLKAGAKYKMEAKGKRYTLTVINTMKDEE
GLYTFAAGEKTTSARLSVTGGAVKRPLQDVTVAESQTAELECEVANPTAEGKWLKDGHPV
EFSDNIRSEEFGAVRKLVIIITRPQDIGEYTYQVANSTTTGNLKVEAVKVKKTLKNQTVT
ETQETVFSLELTHENVKGSQWIKNGVEIRPSDKYEIRVDGMVHSLKIKNCTTQDESVYGF
KLGRLSANARLNVETIKIVKKPKDVTSLEDSTASFELSLSHDNIPVTWMFNSVELKPSEN
CKILSERKAHKLIIQNVNKHNAGEYTAIIGHLQCSATLYVESLRITKTMKNIEVPETQVA
SFECEVSHFNVPSTWLKNGVEIEMSEKFRIVVQGKLHQLKIMNTSREDSAEYTFICGNDK
VSATLTVNPILITSMLKDLNAQERDTITFEVNVNYEGITYKWLKNGVEIRSTERCHIRSK
QLTHSLTIRNVHFGDVGEYQFVAGSAATSANLYVDARVIQITKHIKDIKVIEKKKAVFEC
EVSEPNIQVTWMKDGQELELSDRYKVSTEKYLHRLMIQTVRLSDAGEYCVVAGSSTSKAQ
LTVEGRDVRITDLVEKEITVVEKQRATFEFEVNEDEIEGRWLRNGIEINFSVEERFNYVA
IRKIHRLTISETYRSDAGEYTFIAGRNRSMVTLHVNIPEPPQIIQHMKPQSVEAGKPARF
SVVVTGVPQPQVFWYKNSQILSSGFKCKFLQDGNEYTLLLVEAFPEDAAVYSCEAKNESG
EDTSSATLDVKVPEMVSPDTGTPLSPPVVISPICNTSAKEGESARFQCCVSGKDLEITWY
SKDKEIKQSSTIRMSQFDDNYQLELARVYCVDAGEYTYVARNSAGMVSCSAVLTIDGQTE
DSTSKFLYYDSTNLSTSAVNVKQKAIGQKPTFIKPIMSCTVSHGEVARFHACVFGMPKPD
ISWFHNHELMKPTKNVVFHFDEMTNIATLIIVDAFFEHAGQYTCKATNAAGVAVCTATLA
VTKEDMKTETELETEDVEDFLKLTITKEEEEQEYHSSSLEFTEKTKILELKPESKIFSST
LANKNEGPVFVSQLSSAHASVGEMVKFTVTVSGIPKPNIQWFHNGRAITSSSVYTFVQEK
DEYNLIISQVKTEYEGEYSCTASNRSGQATSKAFLYVEVKELEHCVGEKFEVTGQPPLFS
VPIKTILCTEGSQADFQYKLTGNPYPEVKWFRERFQIQPSKRFKLLSNPDGFSSLNIKDL
KVEDSGIYTCRASNPSGESSCSAELVVFHKLVSHQHKDMTVTKQHSYKASKTEEATESRL
YMVHLPGEARASLQSGQKLVYTIGTENRRTIASEQVDSLREIDVSVATLHKERVTQQAAV
LQSKNVEEGVTVAPAQPLPSALAPIQQFHATSFASAVQECQGFREQHVDHIESPEAIELQ
VTWEKPSKIMSAVAEEVTPLSSTTEILSEGKTKKMESTPEPRHCVSSHHEETRLYIVDEG
SEIIPMPEVEKSYNVKEGVKILYSATSTEKQQFSEAHVTELSISESTTSSAIKEELKPAQ
ASITEKKYFLSKEETFDVHRLKEEKAIKCKDTNLKSCLTTEERQELQAEKTKQIPDLESA
VCLSFQEEGKQALHLQVIQDQNVLPSEGRFICKKPVAEKTDIIKSPPLLYTVTMDEQKSI
SYEESSKFYSEERTFSVQAIKEKPATFHLQSIEVECILPKEDILKAEKPEQQIAVEKLEK
VRKQAVTAEEKRELTADFSEDIDSSVIGVYPEHKKERKPQNILQVISEPMQLPKESPFTT
DVKQQRALVQKEDRWNIMHLMTTEDNKTLEEGHTDILSVVEKCNCQAKFESKIPTELVYI
EEKAISTESSIVLDAAEQDFATQIQEGQSVRKSILMEEKQIIIGEKSQELQKSDTNTVCM
IMQPKQALKVHESQESQTLPKELTFIIQTPKSFSLDIKQQLKNALQSAVAQEQPLLLAEV
VQSLDTVEVKEVKICKEPKYTTFTYLVITSGAPLEVTIAFDGDYPQTADLKSELQAAFCS
LIYQEQHVMSSEKPGIKQIDRPDRLQVSGTSSEEVLPTVVKAVTCAENVTEFTSPKVQLA
ALKTESQAAFQSVKVWDKTTIQESRENVSTLTESIKVIKTTAEEYKESVQMNRQEQKTVT
VKGQQIDGGGAHSYSDISPAQIPIHLSRVDVQKEGVEQFAKDYPVIETFLEDKAVDEHST
VTFSVTIRCVKQVNWFFNGKLAKSGKEFKCSKDHDTYTLVINKVIKEKHEGEYVCEAVNE
AGKTSTSSKLTVVLRVAPVFKHKIQPLEVSVGNRAKFECEIEEAPNVKFKWYKAGIEVRE
SEKCKIFSHHLTTSMELLNLTKADTGEYTCKATNQHGSDSCSAFLNVSEVFPPVFTTKPE
PMTLYVGKQASIQCVVTGSTPLSVVWQKDNVSISSGENYRASVDKNRYTLEIVKLQVADQ
GTYICKASNIVGTDMCCTELSVIDKPSFVKTLTPMTVAVGNPLRLECQVDEDTGVGITWT
RDGRKLHNSMDLKLTFEDKIVALEIPHAKLKDTGTYTCTAANDAGSSSCSSTITVQEPPT
FLKRLEPKILWKQGATARMQCTVKGSPELHVTWFMNDKELTTGEKHKITFKDGQATLEMS
HLTVADSGHYTCEVLNEAGCESCSSSVTVKEPPSFKKELQTVEVVKGTTALFECEVSGTA
PFEVSWYKNKKPISSDKKYKIVCQDNIATLEVNSFESADIGDYQCVVSNDVGKISCKSTG
RLKEPPSFFKKIENTSAILGNSVRLQGSLKGSAPITVKWLKDSEILSAEDDANVTMTFEN
NVAVLAIKTVNVTHSGKYTCQAENEAGKQQCEATLSVEEPAQIVDKTPSVSVTAGEPVTL
ECTVSGSPELKVKWFRDGKEMTASRKYKMMFKDNVAVLKILAAEKGDSCEYTVEVANRVG
KDQCSCSVTVLDRIIPPSFTKNLKKIDGNIGMNVSMECKVSGSQPITISWYKDEKEIKAS
AKYQMDFKENTAALGIFQLEKSDAGLYTCRATNTAGYKETSGTMSVKEPPAFIIKPDSQD
VIPGSTVILKSAFTGTPPFTIKWFKGDEEMSTGGTCFVKKDASSTFMELHSVKPTDSDNY
TCQVANDAGKVTCTAILFVKEPPKFVMKLESSKLVKSGSTIILECKVTGSPTIKIKWFKN
ETEITSDDKYQMTFSNSVATLQIVKSAVDDSGHYICEASSEAGCDRCNCVVTVKEPPTFL
KAFESKEVVKGSDVVLEGNISGSSPFEVTWYRDNKIIRNDKKHKINIFEDAVALQILKCE
VGDVGNYQCIVTNEVGESSCDCQVALKEPPSFVQKIENINSVVGSEITMQCSLKGSLPIA
ILWLKDDRELKEDENIKFFYEDQTVQLHITNIQLKHEGKYICQAKNEAGSQKCSASLIVK
EPAHITEKAKSISVTAGDPATLECRFSGTKVLKARWLKDGKELTTGQKYKVHHTDKNSML
KILSADKRDGGEYIFEISNDVGSSTCEATVTVLDQIIKPSFTRKLKSVDSIKGSFAHLEC
LISGSLPINVCWYKDNKEITADDKHKCTFFENTAFLEISRLDSSDSGSYTCIAKNEAGSD
QCSGTLFVKEPPIILEKPNSADVLPGSRVQFSVLFSGTPPLTIKWFKDSKEILSSSQCAI
QKDNTSSLLELFFTKTSDSGEYSCEICNDVGSEFCQAALFVKEPPKFTKKPERITVTKIG
QTVRFECQVVGTPEIDIYWFKDGNEISPSDKFKMSYENSLVSLEILCTETKDSGVYYCEA
RNEAGSESCSMELKVKEPPAFVQELTPLEVVNGSDASFKCQVTGTPPFEVSWQKDAKEIT
PDKRHIVLQSNGFVSFAILKCEALDVGDYQCTVANEVGKCSCAAALRTKEPPSFVKKIQN
VAVFLGKTAEFQCVVAGSPPLTVQWQKDEDWLVEDANIEQKFEDNTASLRIMACEASHSG
RYTCQVTNEAGLVKSFATLVVQEPPQITEKPEMINVTAGDPVSFECKVSGTPELKVRWLK
DGKELTSSRHYKLSFENNISSFKIQSAQTGDGGDYMFEVANAFGVCHCKVTLVVLEQIIA
PSFLKPLREMHEVLGSFVKIQCTFSGSLPISVEWQKDGNIISAGTKYKLLQEDNYVSLDI
EHLEKADGGEYVCKLTNKAGTCECRGSLIVKEPPGFALKLEPQAVLPNSTVRFKSTLKGT
PPFTVKWFKEETELITGPSCFTGLEGSSCFLDLYTVGVSQSGIYTCQVSNDAGTARCTAE
LLVKEPPEFVLKLPPTKFVKQYEALRLECKVIGTPLIRILWYKNENVIAEGGNYKMSFVD
SVAVLEIPISRFEDDGIYTCEAQNDAGSISCSTTLIVKDPPSFIKVPTSVEGTRGRDASL
DCELKGTPPFEITWYKDKKPVKESRKYKFVLEGCSVTLHILSLDASDVGEYQCRALNNVG
SDTCSSTVKLREPPVFVKKLSNLSVISGEEATFIATVKGSQPMTVSWVQDKDHVLRDGDN
RKITFEDNQTTLRIFKADETCAGKYTCQVKNDSGVVESVAKLTVLEPASIVDRPESFSVT
AGDTAALEVTVAGTPELKPKWFKDGVELSSGKKYKITFSKMVSTLKVLSVESLDSGEYTF
EIKNEVGCDLCKISLTVLDKIIPPTFIRKLKDSHLIVGKPGQMDCKVSGSPPFIISWYHD
GEEITSGPNHEVAFCDNTCTLNMPILKLSDSGVYTCKAVNTAGASETSATLYVKEPPSFV
ERPQPLEALPGTDVTFSAIVKGSAPLKLKWFRGSKEIISGQGCEIALQGNIATLKLFKID
KSHAGEYTCQVINDAGKENCPVSLFVKEPAHFVKKLKDLAVEIGKLLFLECTYAGSPEIQ
VKWFKDGHELYSSYKYNITTTESSCILECLNCDKDDSGKYSCEVSNGAGSDSCHTQVSIL
EPPYFIENLEPMDVTVGDAVCLKCQIGGTPEIKVSWFKVDGKVRSSAACKIEFSRGIACL
KLSKVCKSDIGEYTCKAENRIGSASSSCRLTVQEAKTPPSFPKKIMSLQQTEGQPVRFEC
RVAGSSPMEVSWLKDGESLQHGDEYSMSFDDNSAVLTISRGEMRHSGEYTCVATNSVGTA
SCRAKLTLQEPRYPPVFDKKLQPVEVLVGDSVDLECHMTGSLPIKVTWSKDHKDIRAAGN
YKISCLENSPHLTILKADKADSGQYSCHASNDIGKDSCTTQVSVKERKIPPSFTKKPSEV
MVDVEGKVVKLEGRVAGSQPMSISWFRDNCEIYSSDNVEISFRSNVAVLSIKKAQLSDSG
TYTCQASNEAGSASYQVSLSITEQKMPPMFDRPLKAVSVNEGESLHLSCQVRGSPPLTIQ
WMKDRKEITSSANMRITFVEGTATLEISATSKSDGGDYLCKVTNDAGNEFSKSRVTIKEK
AGVAPAAAEAMPALAKPVKKLENLFFVDEPKSVKVTEKGTATFFAKVGGDPIPSVKWMKG
KWRQITHGGRITVEQKGQDCKLEIREVTRTDSGQYRCVALNKHGEIECSTDLKVEEKKEA
TLLEGDLRAKLKKTPSKQKSPKEAQEIDIVALLRNVDPKEYEKYARMYGITDFRGLLQAI
ECIKKEKEHETGSPEVEYADRESNLDLVKLVSDLQRRMEQTEPITLVKDITDQTTVKDNQ
AVFECEIKINYPEITLTWYKGTQKLESNDKYEITVVGDRHLLTIKNCQSVDQGNYRIVCG
PHISSARLTVNEAKEEEHMSPVTANQIHFTKRIQNIEVNERQSAIFECEVSFDSAIVTWY
KGTWELKESLKYSFRSEGRRHFMIIHNVTSEDEGVYSVIARLEPNGEAKSTAELYLSSKE
INAGKYPTVLDVPESSIQVPGMPSSITPRAKVEDTVVRADVETSDEGQIKVPEPVAPSLP
EASTATKAALPTKDEPEPKPTPSKTAEAYPSRVPKKAEQTATTQKWEEMSYEFEISHTEE
SYLQKDTYYHAELCSDQKEMLGTEDTPVFRDKIISKMEDDSQHLKHKTLKNGDKKKVEPS
KKKDVPGMTDESPQITIFQKKSSSLDEASFVFQGFLKDPHEDIEPNVLVPEKKEQSETTA
LPEEVPDSVNQVVCLKVPKVGKKVTPEPTKNAHVLLQEKASPPEDKPNEVTSSFKPKGKI
STVEETFEMSSLKKATMLSKGMEEEEPAKLKTMSKFLTDEMLRVPETTLQKARKTPSHEK
EEKMTSSTVTQEVEGINEAAKVPKEEIPQEPSFTFELSKVPTKHVEQEAVTLIPFEKLAK
TEEVLDKEIKHDEEIRPLVFKPSDRPQKDESVKGMSLKVDRNLKDEKVQESIVLKPVDKK
LIAEKPQELGKPLPKVKRVTTHEQKKEKVELKPFSKTPELEVSTLPTKQVEQKAITLTTF
ENPAKTEVELDYENKHDEEIKSLVFKPSDKPQKVESDKGIPLKADRNLKVEKEQESIVLK
PVVKKLIGEKPREPGKPLSKVKRVPAHKQEKEKVELKPFSKAPELEVSKLPTKQVEQEAV
TLIPLEKLAKTEEVLEKEIKHVEEIKPLVFKPSDRPQEDKSIKESFSLKADKNLKDEKEQ
ESIVLKPVDKKLIGDKPQEPGKPLPKVKRIPTHEQEKEKVELKPFSKAPKLEVSTLPTRQ
VDQEAVTLIPFEKLAKTEEELDKDIKCDEEIRPLVFKPSDRPQEDESIKESISLKADRNL
KDEKGQKDDVLKPVDKKFIGEKSQEPVKPLSKVKRFPTHEQEMEKAELKPFAIAPELELT
TQKITSLSYRKDSTLKKPEKDAKKEKVKDLSTLPKGAEIPAVPEKETEKTTKTITPHEKE
EKVVTPKEMPLKREKGSLKEDETSMPIKRTAHLPKESDENDRKKEIPQKHIEISTPELQL
KKTSSSKTDILIPKDIELCSVESKPSIQDTKVLPKKLSPKDSIETVTLKKVPRKQTPPDK
KTSEEAPVTAGKGIIPAMKEMSPESIQFRQVPTQNKGDVLEEGSEIEAESEEDTLGSELT
PLESYVSSEDWEETASEEGALETPGMKGEKRAKKTPSPGDGEKKKKLKPGAGGDKPPGDA
PFGFQLKAVPLKFVKELKDIVLQEAESIGSSAVFECQISPSTAITSWMKDGSNLRESPKY
KFTSDGKDRKLAIVDVQLSDTGEYTCVAKLGNKEKTSTAKLVVEELPVRFTKNLEEEISV
IKGQPLYLTCELNKERDVVWKKNGIPIQRTPGKLAINVIGLQHAVTIQNTTDDDAGVYSC
ECENIKTEENVKVVEIIRDWLMKPLRDQHVKPKATATFKCELFKDTPNWKWFKGDEEIPS
EPTDKTEVSKDDRIITLNVKNASPDDVGEYAMEVEGRRYPAKLTLGEREAEILKPLTSVE
VYEKETANFETEISEEDIPGEWKLKGQILTRSPTCDIRSEGRKRFLTLKNLEVEQSGEIS
YQALNALTTAMLTVKEIEMDFTVPLKDVSVPEKKQALFECTITRDVPKVMWLKGSDIITS
GTKYDIIDNGKKHILLINECEFDDEDQYTIEVLDKKSTARLTVEGMRLKLTTPLNDQIVK
EGKTARFELELSHENVPVTWYKNEMKLHPSRTVVSYVDGKKHVLEIKEVTLDDTCQIKAE
AKGISTMANLTVIEADPYFTVKLQDYTAVEKDEVILDCELSKDVPVKWYHNETEVTASKM
VSMKADGKRRILSIKRVDNKDKGTYVCDCGTDKTVAEVNIKARDIKVVRPLYGVELFDGE
TARFEVEISEDDVHVQWILNGEVLSPSPNVEIIEDGAKHILTLYNCKVPQSGEVEFQAAN
AMCRATLKVKELPLTFITPLGDVQVFEKDEARFECEVSRDIKDFHWLKESQELRADEKFE
VLNEGKKHVLVVKSAAYEDEAKYTFEAENKRSSGKLIIKGIRLEFIKPIKDVTVKERETA
EFSIELSHEKVSVTWYKNDVRLHPSKVIRMSEDGKIHILTFKEVSLDDTSVIKAEALGKS
TEAMLTVLEGDPYFITQLQDCTAVEKDEVVLICEVNKAAAEVKWFKDGKEITPSKNVLVK
SDGNRRILTVKKAEKGNSGEYTCDCGSDKTAAKLNIEERDIKIIRPLYSVEVIETESARF
ETEISEQDVHGNWKLNGEALHQSPDCEIKEEGTKHILILHNVFMNQAGRIEFQAANAKSS
AQLRVKARVIGVVRPLRDVTVTVGETATFECELNYEGIVVDWFLKGTKLVPSDRVVSRAD
GKVHTLSIRDIKLDEAGQIKLTTEDFLTHAKLIVNEPPAEFTKPLEDQTVEEEATVTLEC
EVSSEKAEVKWFRDGQEIRKTKKYNIVADGRKRKLIIQGCTLDDSKTYTCDAKDCKTSAF
LNVEPLRVEFTKPLHDVEVKEKDSARFECEVSRENAKVQWFKDGSEIRKGKKYDIIAKGV
QRILIINKSVFEDEAEYECDARTAKTSGMLTVIEEEAVFTKNLSNTEGTETDSIKMICEV
SKPSAEVRWFKGDQELPEGGRFEQIQDGRKRILIIRDLRMDDVGEYNCRLPSSQTSATLR
INELPAEFITRPQSQEVVEGEKAEFVCSVSKDTYEVKWFKDDKELEVGDKYDIVFDGKRR
ALIVKDCLLKDEGPYVADIGSSRATADLIVIEKLRILTPLKDINITEGQDIVFNCEVNTE
GAKAKWLKNNETMFETGKFVMTQKDNVFSLRIKDTQKSDEANYTITLTNQRGEYVQSSAN
LIVQEDELRITEPLEDCESQEKRTITFSCKVNKPNVAVKWMKGGQEITFDKRILYKVDKT
KHTLTIKDCSLADEAEYSVIIGSEKSTAELIISEAPTDFITYLRDQTVTEFEDAEFSCKL
SKEKAEVRWYKDGREIKEGPRYHLEKEGKICRLYIKECRPDDECEYACGVDDRRSRARLF
VEEMPVEIIRPPANVFEPPGSDVVFEVELNKDRVDVKWLRNNMVIVQGDKYQMMSEGKVH
RLQVCEIRPRDQGEYRVIAKDKDARAKLELAAAPKIKTTDQNLVTDAGKPLVMTVPYDAY
PRAEAEWFYDDILLPGQNIDTSNDRTEYRLKDPKKSDQGRYKIVLQNKYGMGQAIINLDV
IDVPGPVKNLKVVDTADGEVTLAWDEPESDGGSKLIAYVVERRDIKRKTWTTITNHADSP
EYCVTDLKRDSMYLFRVCARNRVGSGPSVETDEAVQAKNMFDVPEAPRNVMVGNINKFGA
TISWEPPEYDGGSEITAYIIELRDRTSVRWEPALVTKPEDRKAVVNDVVENKEYIFRVRA
ENKAGIGKPSVATDPVKIMDPTERPSPPLNFDYSDQTKTSVLLTWDTPLSNGGSPITGYI
IEKCEDGTDKWLRCNARLCQDLCYQVTGLKHEQKYNYRVSAENAAGVSDPAEQIGPLTAD
DPHVAPTMDLSAFRDGLEVIVPHPLTIHIPITGYPLPTAHWSVADKALAAGDTVSMVTKN
TFTKLVITPSVRPDKGIYTIHLENDVSTISGEIDVNVIAPPSVPRDFKVAEVTRHHVHLM
WEAPQDDGGSPVIGYQIEKREASRKTWVKVITGVEQLEYTVTDVIEGREYLFRVTACNKC
GPGEPAYIEEPVNVSSPATVPDPPENLKWRDKSANGIFLSWDPPKCDGGSVIKGYIVDKC
QRGTDKWEPCGDPVHEPKFQVTGLTEGQWYSYRVRALNRLGASKPSKVTDEILAVDPIEP
PEIMLDVKLLAGLTAKAGTKIELPADVLGKPEPKVTWTKADLVLKADDRVSIETKPGHST
VSIAKTKREDTATYIIEAVNVAGRATATVDVNILDKPGPPAAFDITEITNESCLLAWNPP
RDDGGSRITNYIVERKTSGSEDWCKLSSTVKQTSFKACSLVALKEYVFRVFAENQYGIGP
PIEHVPIIAKYSFDSPSAPSRPMPSDIAKDSLTLTWYEPDDDGGSPITGYWVERFDPEND
KWIKCNKIPIQDTTFRVKGLATKKKYKFRVLAENRAGLGKPSEDTGQVLVKDPIDPPWPP
GKPVIKDVAKTSVLLKWTKPEHDGGAKIHSYVIELLKTGTEEWVCVAEDVPMTEHFLKGL
MERQEYSFRIRAVNIAGESEPSDPSDPIICKESLYPPSPPRWLEVVNITKINAELKWTFP
EKDGGSPITNYIVEKRDVRRKAWQTADTTVKETKYTVTPLNEGSLYVFRVAAENAVGQSD
FCELEDSVLAKDTFTTPGPPYALTVVAVKKRHVDLKWEAPKNDGGRPITKYVIEKKDKLG
TRWVKVGKTQGPECTYQVTDVIEGSEVQFQVRAENEAGVGPPSEPTDVLTIEDPTSPPSP
PRELHVTDTSRDHISVTWNPPEKNGGSPILGYHIELCEAGTEKWMRVNPRLIKELKFKAE
EGIIPEKQYTLRVRAVNAIGVSDPSEVSENISAKDPDCAPTLDLLTQDIVVIEGQKLQLP
VHYRAIPSPSVSWQKDGTNLIPDDRLHLSCDRAIAHIKISKCNHEDAGIYTVTLENKLGA
ITGTVNVIVIGVPGKCKDIAASEVTKNSCKISWKPPDFDGGSPILHYVLERKEASKKTYR
PVMSGENVLSWNVKDLLVNAVYYFRVRAVNKVGGGEYTEIHNPVITEDQKDRPDPPVGVK
VDNITSQSVHLTWNPPAFDGGCPITGYILEKIEKDGTKFERCNESLVPGFSYTLKGLMEG
KEYQFRVRAENAVGVSDPSNSTALVKAIDPADPPKVSLRGSLNIRKGEEIQLDAIISGSP
YPAVTWLRNDEAIQPENIRKRQQKSAVRRKAKGIHSQLEEPYQLSLPERLSFDFSKKGEA
TLMVRDSIRSDHGIFTVKAKNAHGTATAICDVNVLDVPGPPINFVFEEIRNTSVICMWDP
PMDNGGSEILNYILEKKDKTKDESSWITINSTLRSCRFHVTKLIETKEYIFRVTAENNLG
PGPACYSAPLVAKNPFDPPDAPNMPRIGDVTAKTMLISWNEPKDNGSPILGYWIEKREIN
SKYWTRINRNLLNSLEMRVSGLVEGLTYVFRVCAENLAGPGNFSVPSEPKIAQDPILPPG
PPVPRIVDTTQSSIEITWDAPLYTGGGDILGYHVEKILAGEKVWSRCTERLCKDHNFTLC
GVTEGADYIVRVIAVNDAGEGAPGMTQLVTVKEPQDPPLVEFDISVKKGVTVRAGEKLKL
PAHITGRPQPQVNWMKDGGHVDQEHAVIETVGKNSTLSIKHALRTDHGKYQVTGSNSSGT
KTAFTKVDVMDVPGPVVDLKTTAVTKKMMTLSWCDPIDNGGSDITGYIVERKDANMHIWR
QPMETTSCKCEIRGFLEGRQYMFRVVAKNKYGCGQPVDLGPILAVDPKGPPSAPQQFHYT
ERSKSSIRLSWKPPQSDGGSPIWGYYVEKRRQGETEFEVANRQICKTLSLMVENLSEHHM
YDFRVKAVNEVGEGEPTEILSSIIQDDEVKPSVMLLKHFKGDVIRAKKGEAVEIPAEVTG
LPMPKIEWSKDGTGIDKPTEILLIDTKEVSNKTAKTTLSIPETQRHDKGLYKLTASNFLG
SADVNIRVEIFDRPSAPRNIVVADIKAGSCYLTWDDPEDNGGSEITNYIIEKRDGSKKKS
DWEEITSCVLEKRYRVSKHETNGIYQFRIKAENKYGISDGCESEKVILKDPYGLPGPPQR
PKVIGHSQSSMLVTWEPPLDNGGSPITGYWIEKREKGAVYWNRVNRAPITKPAVKGLEFN
VLHLNKGCEYQFRVMACNAAGVGPPSEPTESAFAADPQNPPGMPSSPEITDKTRNSITLS
WKPPEKDGGSPIKGYIVEIQDEDSIEWKPVNELEKPHPTSQFTVSNLEEMKKYKFRIIAV
NDAGKSEPSPATSEILVKEIKEEPKVTLNVSAHEFLSCKAGSSIKIPATITGHPTPKVSW
EYDGKAKTEKKDGLHILPLDSQIISTDTTSTIIIPECKLYHTGKYIISAENEAGQKLLKV
LVNVFDLPGPPRELKVSDITRGSCRLTWKPPDTDGGERVKSYFVEKKTVEGKAWTKVNSA
CVSQTFVVPDLIEGQEYLFRVRAENSLGLGPCTETVQRTKARDPVYPPDPPRRVKINAVM
KNTVTLTWKPPKNDGGAPVTHYIVECLCWEPSGSQKEYWRQCNKRDIENTTFMIEDLTED
KEYEFRVKAVNNAGASRPSSTVGPVTAKEQTCAPAVELNEFMEVEQGTDINILAKIKGCP
FPTITWQKAQPHKSNEKTEVQYDEHINKLVTDNSCTLLIRQGKRTDTGLYTITASNGLGT
ASKEMRLNVLGCPGPPSAPIKFEEISAGKITLSWLPPKDDGGSKITNYVLQKRVANRKMW
VPVTSNAKERIYTVENLMEGHHYVFRIMAQNKYGIGDPLDSEPEQARDHFNVPGQCEKPT
ISSVTHDSMTVNWEEPEHDGGTPVTGYWLERKETTSKRWNRVTRDPIKVLPFGISHNVTG
LIEGSQYQFRVTAVNAAGCGPPSLPSDPVFARDPTAPPGPPIPKVTDWTKSTVDVEWLPP
LKDGGSKITGYFVEYKEEGHEEWKRAKDKEVRGTKLVVAGLKELGLYQFRVRAVNVAGIG
EPGYVSDVIKVMDRTILPEVNLDASVKERLVVHAGGVIRILAYVSGKPVPKITWNRDNDV
LPEEAIIETTAISSALVIKKCTRKHQGIYTLTAKNEGGEKKKTIVVDVLDVPGPVGTPIT
TENLTSDSCKINWFNPDDDGGSAVTNFIIEKREVDHKAWTPVSCSVTRHSAVARGLINGK
AYFFRIAAENVIGIGPFVETTKEIVIKDHITVPERPEDLEVTAVSKEYISLKWKPPKFNG
GSEIIRYILEARPIGKDKFIRLTKEKLMERKYTYAGVKEGDIYEFRVSAVNEIGQGKPSF
STKPITCKDELEPPTIELEFRDKVIVRVGESFALQGRYTGKPAPSIIWTKDDKELKADDQ
IKIKSTPTTMFLGIIKAKREHSGRYCVIVENCTGSRKGICNVTVVDRPLPPQGPVVFEEV
HRDHIVISWKTPLDDGGSEISNYIIEKQDTSRDLWMTVTSASTKTTCKVPKLIEGKEYIM
RICAENMYGISDPLESEPVTAKDLFRVPEAPEQPVIKEVHKDTALVIWNRPRDGGKPITN
YLLEKKETTSKRWSRVTRKIIYPDTQFRVEELLEGCEYEFRVMAENEIGVGDPSPPSKPI
LAKEPIVPPSPPVLPEVVDKTKESVNLIWQPPRRDGKGRILGYLVEYQKIGEEEWAKANE
TPESCQETNFKVINLSDGEMYKFRIMAVNTAGKSEPAYVKDPVKVQDRLEPPELLLHANM
AREHLAMEGTTIILSAGIRGIPFPKVTWAKNNAEVPPRANIEVSGDESKLIIQNCLRSDC
GDYAITVENPAGSKTATCTVLVLGKPSPPRNLMITEVTSESAYLTWKEPEDDGGAVISNY
VIEKKDVASEKWVPVCASSKKPSLLAMYLMEGTQYMFRVAAENQFGKSEYISTTKPIKAV
DPIYPPGPPKNLHHVDIDKTEVWLQWDWPDRTGGSDITGFLVEYQEEGAKDWIPFKTVRK
TESHVTGLQEGKMYRFRVKAENAVGLSRPDITVPIVCEEKLVPPAIEVDVKLIEGIIVKA
GSTIKLPAIMRGIPVPSPRWLTGGNEIKSEDNINIETFNYSTVLNINNCKRSDTGEYLLT
VSNPAGSKTVALHVTVLDVPASPTGPVNILEVTSEHMIINWRPPKDDGGTPLINYIVEKK
DTKKPWEPWAIVSSRGTGTKAKISHLEKGREYIVRIRAENKVGIGPALESPPTIAKLIFD
PPSAPGQPVPHDITENAVTVKWEVPLCDGGSPITGYIVERREMTGKWIRVNKIPVLDIRY
RASGLFEGNTYEFRIFAENTAGISEPSPVSDPVKLTRPVTCPGPPNNFRLKDWSKSFVDL
VWTKPTRDGGSPVLGYIVECQKLGSVHWDRINKDDLIKQCIYRVPGLTEGLEYRFRVRAA
NKIGEGEPKELSETVLAKDILVPPEITVDVACRDLVTVRAGQNINLIARVKGRPEPEIIW
TKDAKVLERDKRTEMKNIFPIADMIIQKAARADHGKYTIQARNISGQAQATIIVNVLDRP
GQCQNLKTSYVTKDSCMVSWENPEDNGGTEITNYIIECRQPNQRGWTTISSDCTKRLFKA
QLVENCEYLFRVSAENKCGVGSAAETRMAVLAVDPVEKPGEPENFHITDIGKTFVFLKWK
KPDYDGGSRNLAYHVERKLKEAEEWERLHKGAIKETFFMVDRCIENQIYQFRVQTKNEAG
ESNWVTTAETVVKEEVLQPVLNVNVDGILVVKAGDSIKIEAGLKGKPHPEVKWFKDGDTG
DINKSPRVHIENGSNFSKFVMTSSKRGDSGTYVITATNSAGSCSANVIVNVLDKPGPVRD
LAVSGISMDRCKLTWVHPEDDGGCEIQNYILEKCETKRMVWSIHSAAVITNFANVIHLLE
GNEYIFRVRAENKLGTGPPVESKPIIARTEFNRPGPPGQPEVTKIGKEEMTVSWCPPQYD
GGKPIKGYILERKEQHAVRWVPVTKSPVQQAHMNVTNLIPNHEYQFRVKAENEVGMGDPS
KPSISVTAKDPIGPPGPPGDLKVTDSTRTSITVGWLRPAYDGGAPIIGYVVEFRIKDASK
KPDEGWKRCNVAAQLTITEFTVTSLDEKLEYEFRVSAQNQVGMSQPADLKGAVSPREITE
APEIDLDATLRKGIAVRAGCPIRLWATVKGRPAPKMTWRRMGIDNVVRKGHVDFIDTMAF
LVIPETTRDDSGKYSLTLSNSAGEKAVFVDVQVLDTPGPVVGLDATDIKMTSCNLSWSPP
ENDGGREISHYIVEKREVNRKTWATVNNGVKETTLKINNLTPGTEYCFRVTAVNEYGAGV
PRISPSSYLTSDPISKPDPPVKMDVMEITKNSVTLGWVKPLWDGGAKIDGYVVDYLLVTP
PKEPEEDQAVLLEQNKLKEQWTPYSVVKDLSITIAGLKEGMKYKFRVAARNVMGSSLPTE
TSGVFEIKEQMLAPRIVMADVATAKAGEKLRVEALVTGKPAPVCKWKREDEDVVPSSRLA
VHKSPNSCVLIIKDVSRMDSGLYSLSAENITGQAEEILKVIIKDTPGPPQPPFEISEVDA
DACSLSWLAPLEDGGSSITNYVVEKCDVSRGDWITAVSSCTKTSCRLGKLVPGKEYIFRV
RAENCFGISEPIVSEKMIAKFPFDVPSEPLNCHINKVSKDCMFVAWEKPAIDGGSTITGY
YIERKEKNSLLWIKANDTVVRTTEFPCAGLIEGLEYAFRVSALNRAGQGKPSKMTEFTAA
RTPVDQPGKPEVIDVTKNSVTLVWDRPKHDGGSKIIGYYIEMLKLPEDQWIRYNTSSQNV
PVEEFTVTRLQEGVQYQFRILAKTAVNLSKPSDVSDPVLIFAENVPPRVEIGLQMKRLLP
VKAGANACLEAEVFGKPVPKVTWKRNGELLKPSERLKMSQRRHLFFLELLSVTKNDSGEY
TILAENASGSKSGNIKLTVMDVPGPPVSVKFGDIFAERINLIWEPPILDGGSAITNYIVD
KRETSRANWAQVTSKISGQLTNYSVEKLIQGHEYQFRIRAENKYGVGEPILTEPAVARNS
FDVPGSCEPPIITNITKDHMTVSWKEPANDGGSTILGYMVEKRETKEVNWAKLNRKPVIE
RTIEASDLTDGGEYEFRVTALNKAGLGKPSDPSSAVIAHDPLYPPGPPVSPKIVDITRST
VNLTWEKPVNDGGCEILGYLVESKRADSAEWIRCNVPKNLRETKYLVTGLQDNMEYQFRV
TATNKVGFSQPSEVPGKYTVKDILVPPEAELNGELMKTLELRAGTPMKLYVPIKGRPIPK
VTWAKMNTNIKERQGIVIKTTEWDTLLYIEKVNRYDAGKYILNLENSTGIKTYTIVVKVL
DTPGPPLNLTVNETSKDSASILWDAPLIDGGSPVKQYIVEKRDAERKSWSTVTLDCTKTS
FTVEGLEAGRCYFFRVLAENEYGIGEPCETADAARASEQPGPVVDFKPLLVTKDLCTLAW
KKPISDGGSRITAYVLEVKNGEDKWKTVMRSKNMQYSAKDLIEGREYSYRVRAVNDAGDG
TVKELNIVAKDLTVPPGCDLRDLPNLCYIAKEGSTVRLKIPIFGKPAPTVIWKKGEDVTL
TDSGRVSVESMAVNTTLLIHDCQRGDASKYTITLRNIAGTRESIIFIRVVGKPGIPTGPI
KFDEITADGMNLKWGAPKDDGGSEITNYILEKRDSVTKMWVTFASSVEMCNFRVTGLHEG
TEYIFRVSAENKYGVGEGLKSDDVVAKHPFNVPDAPPPPQIMAMRCDSAVLAWSDPRKTG
GSPITGYHIEFKERNSLLWKRANSTTVKMKDYTVIGLSEGLEYEFRIMAINIAGIGKPSP
ATEPVIALDPIDPPGKPDVITITRSTVTLQWTEPKYDGGHKLTGYIVEKRELPAKLWMKA
NIINVLDCAFTVTGLQEGCKFEFRIRAKNAAGAISSPSEQTDTIVCKDEYEAPAIIIDPT
VKEGLTVRAGDTIVITATRITGKPPPTSVWSKGGRDFKPSDICQIEKTPTSSTLTIKCAS
RKDSGEYTISASNPFGIKEENVKVTVLDVPGPPGLLEASSVSAEKVTLTWSPPHEDGGSP
VKSYTLEKRETSRLLWTTLAENIIDCHFVTRKLIQGNEYIFRVSALNQYGTGEATQSEPV
KMVDNFGPPGPPSKPETVNVDKDSVTISWKRPVEDGGSDIIGYIVERKEKREMRWIRASK
KMISDLNYKVQGLIEGVEYEFRVIAENKAGFGEPSEPSQSVITKGMTYVPGPPFNPRITD
TTKSTATFTWSRPLYDGGLDITGYIIEHKKETETEWVKDTVGTLRITEFVVSNLQQGGRY
NFRVSAMNAKGVGESAQVEELVEVVERQEIPDFELDAELRRTLVVKAGGSIRIFVPIKGR
PIPKVIWMKEEALIGRAHIDTTESYSLLVIPDCTRHDAGKYMLRLENTAGKKTCCVNVKV
LDSPGPPLNLRPTAINKESITLQWETPIIDGGSKITNYIIEKREATRKAYVAIITNCQKC
SVRVPNLAEGSEYFFRVRAENEFGIGEPVETPNPIRVSQAPAAPEKVNVTDITKNSANLT
WTKPKHDGGSRITAYVIEAQKNGSEQWSHITTLKNLDYVVKNLNENEEYVFRVMAVNNAG
RSDPCESRPVVIKEETTQPEFDLRGICQKLVIVKAGDDLKVEIPVLGCPKPAVTWRKEEQ
ILKQTQRINIENTSISTTLNIRECTRNDSGQYSVTGKNILGTVTETITVKVHDIPGPPRG
PVNFDKICCDSIVISWDSPENDGGVPINSYVVELRETTSTLWVTLSATVIRTMFKAQHLS
TGVEYQFRVKAKNRYGVGPPINSESVIATYPFKVPGPPGTPKVTGFTKNTMTISWNEPVS
DGGSEIIGYHVERKERKSIIWHRVSKGLVVGNIFKTTGLEDGIAYEFRVAAENLAGVGKP
SKPSEAFFALDPVDPPGQPVAINISKSSVTIQWKKPEYDGGFKISGYTVEKRDLPDGRWL
KANFSNILDTTFTISGLTEHSSYEFRVFARNSAGAVSNPSEPSDPIVCKDDIEEPRIMVD
AKFKDVLLTKAGEVFKLEADVTGQPLPFLIWTKDGKEIENTTKVEMKKTDLTTVLINKDS
LRRDGGEFTLTASNPGGFAKHVFIVKVLDRPGPPHGQLAVTDITAENCVLSWLPPLDDGG
AKIEYYVLQKRETSRLAWTNVASDLQVNQFKVTKLLKGNEYIFRVMAVNRYGVGEPLESE
PVVAANPYLPSDPPSAPEVITITKDSMVISWEHPKNNGGTNISNYIIERRDRAGHRWIKC
NKNIVTDVRYKVTGLIQGHEYEFRIIAENAAGLSFPSPSSPFYKASDTIYKPSPPGNPRV
LDTTKSSITLAWNKPVYDGGSDITGYVVETCLPHEDEWTVVTPKEGLVATVFTITNLKEN
QEYKINISAVNCEGVGDPASVPGLPKAEDRQIPPEIELDAELRKIVNIRAGGTLRIFVPI
KGRPAPEVKWSKQNGEPLDRAIIESTTSFTSILVEHVNRFDSGQYILMLENSSGSKTAFV
NVRVLDTPGAPQNFKVKEVTKESVSLTWDPPIIDGGAKIKNYIVEKRESTRKAYSTVNAN
CHKTSWTVDQLQEGCNYYFRVFAENEYGIGLPIESSDSVKVSEKPLPPGKITLQDVTKNS
ATLLWEKPEHDGGSRIVAYVVEMQGKRSETWTQCMLVKATEAVVTGLTEGEEYIFRVSAR
NEKGTSDPRQIGVPVIAKDLIITPSVKLLFSTFSVLAGEDLKVDIPYLARPKAAILWHKD
GCPLKQTSRVNFEMDESQLYLKIKEACRDDVGQYTIQLSNTAGEATANICIVVLDKPGRP
GGPVKITEVTADSVTLSWNPPEYDGGCTINNYTVEKRDTSSTNWQAVNVSLARTTVKVRR
LKTGCEYQFRITAANRYGKSPGLVSEAVLAQYPYKLPGPPGTPFVQEANKDSMVVVWNEP
VIDGGTNILGYHLDRKERNSIIWMKLNKTLIQDLEFKTTGLEEGIEYEYRVYAENIVGIG
KPSKVSESYVARDPCDPPGTPEVATITNNSVALRWTKPEYDGGFKITGYVVEKKELPDGR
WIKANFTNVIETEYVATGLTEGQKYEFRIIAKNAAGLLSDPSNSTGPITAKDEVDPPRIS
IDPQYTQKFVVNAGENFKIAADVQGKPTPLICWMKGNQELFNTKWCEIKNTNSSTCLSVK
DVKRNDGGQYTLKVENTGGQKSVHVNVEVLDKPGPPEGPISVSNVTAEQCIVTWKPPKDD
GGSEILHYIIEKRETSRLVWTTVEPKIKELDFKITKLLEGNEYIFHVMAVNKYGISDSLE
SEAVIAKNPFVTPGAPKNVEISNVTKDSMVVTWEAPANDGGSPITGYIIEKHDKEGVRWT
KCNKCTVTELHFRVTGLLVNHHYEFRVSAENAAGAGEPSSPSPYYKALDPIFPPGPPNNP
KVTDITRTSIFLSWGKPVYDGGCDIQGYIVEGCELTSEEWKMFTPSPGIKCAQFEVDKLK
ENHEYKFRVCAVNKVGVGEHADVSAVLLEDKREEPDLDIDPDLRKTLTVRAGASIRVFIP
IRGRPAPEIKWGKVHGEIRDTAQIEITSSYTSLVIDKVNRFDSGKYTITAENSSGTKTAS
ISVRVLDTPSAPVNLKVKEMTKESVTLTWEPPSLDGGAKIKNYIIEKRETTRKAYSAVST
NCHKLSWKIEPLQEGCSYYFRVYAENEYGIGLPSEIPDPLKVSEVPQPPGKLTVVDITRN
SVSLAWEKPEHDGGSKILHYLVEMQAKGNEKWSVSANVKTLETVITNLVPGEEYVFRVVA
VNEKGKSDPRSLAVPVQTKDLAIEPDVRPAFNNYSVLVNKDLKLEIPISGCPKPNITWKK
DGLTLKQTTRVNVINTSKQTILNIKEVTRDDAGIYAIAASNAVGKKDATIEIITLDKPGP
PTGPIRFDEVSSQSVTISWDPPKYTGGCPILNYIVQKRDTTTTTWENVSTTAIRTTLKIL
HLTTGAEYQFRIIAENRYGKSYALDSASVIAQYPFKEPGPPGTPYVSSLSKNHMIVEWHE
PVSDGGSSVVGYHLERKEKNSIIWTKINKTLIRDTSFKSTPLDEGIEYEFRVYAENIVGI
GRCSKISEGYVARDPCDPPGTPEVTSVTKNSITVHWTRPEYDGGSMITGYIVEKRDIPEG
RWIKANFTNIIETHFTITGLIENCKYDFRIIAKNAVGTISKPSCNTGPITAKDEAEPPRC
STDPEYIQAIVVNAGESFKLEADVYGRPMPTIQWFKDDKEIENSSRCEIKNTESRTMVTV
KDASRIDSGQYNLQVTNVAGSKTVPFHVKVLDVPGMCEGPLDVTSVTSETCTLSWLPPKH
NGGSSIFHYIIERRETSRLAWTVVCSDCEDTLFKVTNLLEGNEYKFRVMAVNKSGIGKPL
ESLPVIMKNQFLPPEAPQALEVINIAKDSMTVCWKRPQIDGGSEIIGYFIEKKEKTGVRW
TRCNRQIVSDLRFRVTGLMEDHDYEFRVYAENAAGVGEPSLPTPCYKACDPMFSPGPPTH
PHVTDITKNSISLTWGKPIYNGGSLIQGYVVEICKANEEEWTMCTPPTGLLVNKFNITNL
SENDEYKIQVCAINKLGVGEAAAIPGTVKPEDKMEPPELSLDSEIRKGLIVHAGRSVKIS
VPFKGRPIPNISWTKEEEDLCKKEKVKIENGINCTQLSIENCNRNDTGKYTVKLENSSGC
VSDFISIKVLDTPGAPQNLVVKDIKKDCITLLWEPPLSDGGAKIRNFIVDKRESTRKVYV
NVTAKCTKTSFKVENLAEGAMYYFRVMAENEYGVSQPIETKSAVRVCEVPLSVRNVTLTD
VTKVSASLAWEKPEHDGGSRIMGYAIEMQVKGTDKWTVATSTKTCEGTVAGLISGQEYLF
RVLAYNEKGKSDPKILATPVTANDLTVEPSFKLLFNTYSVKSGDDLKIEIMVTGCPKPKI
TWMKDGLSLKQTTRINPINTPTSTILQIKEACKDDFGKYSVTATNCAGDSKEEIVIIVFD
KPGPPTGPIQINDVTNNSVTVSWEPPEYKGGCEVKNYVIEKRDTATTAWEVISQTVARTT
IKIYKLKKGSEYQFRVFAENRYGRGSPLISKPVVVQYPYKPPGPPGTPFVTSTTKDCMVI
EWNEPVTDGGSTVIGYHLESKERNSILWTKLNKTLISDTIFKACNLEEGNGYEYRVFAEN
IVGIGKSSKISECFIARDPCDSPGTPEPVIICRNHVTLQWMKPQYDGGSKVTGYIIEKRD
LPEGRWMKANFTNVAETEFTVTGLSEGEKYEFRIIARNAAGIFSQPSESTGPIAAKDDIE
LPRVSMDPKYKDVVVINAGCTLALDANVYGKPEPDVIWLKDGKKFEVTTQKVDIKTTSKS
TVLIVKDCTREDSGCYNLILSNIGGTKTIPITVKVLDRPGSPEGPLQVTEVTADACCLSW
GEPLQDGGAAVDHYIVEKRDTSKLSWTVVKPKVKALSCKVTNLLVGNEYIFRTMAVNKYG
ISEPLESEPVTAKHPFKPPSPPSMPEATCITGDSMVIKWEQPEYNGGSDIHNYHLEKRDK
DGVRWTKCNKTELSDLNFKVTGLTEGHFYEFRVSAENEAGVGPPSEPSLFYRACNAARPP
GPPNHPKVTDHTSSTVTLSWSKPLDDGGAYIKGYIVEMKEVTHEDWSTCTPSTGIQATQY
KVEKLKENTKYNFRICAFNAEGVGEHADIHGSIAAVEKQEVPEAELDAELRKVVSVRASG
TLRIFVVIRGRPEPKVKWEKAEGSLTERAQTETTSSYTMLVIDNVNRCDSGKYILTLENN
NGTKTVFVNVRVMDSPSSPLNFVIKDIKNDSVTLSWDSPAFDGGAKITNYIIEKRESTRK
AYTTVTSNCTSNSFVIGQLQQGGIYYFRVQAVNEHGVGLPAETKDPVKVSEPPMPPGKIK
LVDVTRNSVTLSWEKPDNDGGSKIICYNVEMQTKGSERWIATGTFRALEAIITGLVPGDE
YSFRISAVNEKGTSEPKQLGVPVIAKDIEIEPTIDMPFNTYSIKAGKDLTVEVPFKGRPK
PVISWKKDGLPLKQTTSVTLLSSMTSAKLFFKEASREHVGKYEITLTNAGGTKTEEILIV
VLDKPGSPAAIRVDEVTAESISLSWEPPIFNGGCHINSYIVEKRDANTSVWQIVSSTVAR
TSIKVSHLTQGSEYQFRVYAINRYGKGPSIDSPVITVQYPFKVPGPPATPRVVQATKEFM
LVTWNEPVNDGGSAVTGYHLECKERNSILWAKINRSLIKNTEFRVTGIEKGLFYEYRVYA
ENIVGVGKCSKACEPVAARDPCDPPGQPTVTNITKTAVSLLWAKPQYDGGAKVTGYIIER
KEEERWIRCNFTNIQETYFDVTGLVENQTYDFRVIAKNAAGLFSQPSDCTGPITVKDDVD
PPRIIMDVNFRNAVVVKAGDSLKIKADIAGRPLPVVSWAKDGKEIDMRARIQIYSTDTST
SVTIKDCVRSDSGQYVLTVKNLAGTKSFPLNCTVLDRPGPSAGPLQVTDLTAATCTLTWG
PPQENGGAEISHYIVEKRETSHLVWTVVHWDIKTTTCKVDKLLKGNEYIFRVLGVNKFGV
GEALESDPIKTTDPFTVPFAPTNVAISNVSSKEMTICWGKPASDGGSEILGYIIEKREKS
SMHWVRVNSKLIYELSVKATKLRNRCEYEFRVFAENAAGISLPSDPCPLTKAEDPPLLPP
SPSKPKIIDSTKSSITLLWNKPQSVGENPVTGYSIEFKKKSDKEWRVAVQNTRNTEYTVS
GLESGAEYVFAVKSINKIGISDPSPPSDPEVANEREEEPLFNVDNEMRKTLIVRHGNSFT
LTAPFRGKPIPTVVWNNEDVNLQERASIDTSDNCTSLTIEKATRKDSGKYTVTLENPVGT
AVLTMTVKVLDSPGPPSDIEIKEVTKDSVTLTWRAPDNDGGDPVKNYHIEKREAIKKAWV
SVTNNCHHLIYKVTNLQEGAIYYFRVIGENEFGLGVPSETDGTKITEKPSTPTKLGVTNV
TKDSVSLAWSKPEFDGGSRITSYLLESLEKGQKKWIKCAVVKTTDHVVHSLRENAEYLFR
VSAENHAGLSEPKEMITPVIVKDKLESPEFDMKNFSRNTVYVRAGSNLKCEIPLTGKPLP
RVTLSKDSIIMKSAKRFKFEVIPESLLINLKESIASDSGRYDITASNSCGVAKTFVNILV
LDRPGPPVGPVEISDVTEDSLCLKWFPPVYDGGSPVTNYVVLKRETSTPAWMEVSSTVAR
SEIKITKLMKGEEYQFRIKAENRFGFSDHIDSKAVTAKLPYTTPGPPSTPWVTMVSRNNI
TVCWHEPVSDGGNPVFGYHLQMKDRNSSVWQKVNKTAIRATQFRVTNICPGLIYEFKVAA
ENSAGIGKISKTSDEVLAIDACEPPGNVRISDITKNSITLVWQKPPYDGGSKVTGYIVEK
RDASKCRWTKANFTNVIETNFTISGLTQDESYEFRVFAKNAASVSNPSVIAGPVKCVDTQ
GTPEIDLPAEYLDVLNYKAGEVVQIQVGIKARPLPVIEWFKDGKEFLSSAQISIESTTDA
SGIIIKDANRFHSGTYEVKIKNALGLASASVRVQILDIPGPPVGPVQFKRVTAENITIAW
NPPIDDGGANVTHYVVEKRETSRTAWSVVSEEHKECTISVEKLVRGSEYVFRVRGMNKYG
IGEPLESAPVIAKNAFVTPGQPSTPEAINITRSTMTVVWERPGVDGGSDITGYYLEMRDK
NTLRWQKVMKAPVCDTIKNILNLTGGKEYQYRVNAINRAGEGPYSDVSDFYKAVDPIQPP
DEPNKLKVVDSTKTSITLGWGKPEYDGGSEITSYVVEKRVAEEEEWVVISSKGEIRTTEY
VVSHLQPETDYFFRVSAVNCAGQGKPIEIVEPVQAKDILEEAQIDSDIALRTQYTVKAGT
DVEIMVPFKGRPVPNVTWKVDETDICNDPKYKIHNNESSTLLIIPLVTRNDTNKYILELE
NGVGEPKKVTIFVKVLDTPSVCQKLQIKNVTRGKVTLSWEEPLLDGGAPVINYIIEKKDS
AKRSYTSVTTKCASTTYEIDKLSEKSSYFFRVSAENENGIGDPCETAEPVKATEIPGQVK
NISMKDSTKTSVTLQWSKPDYDGGSIISDYVIEKKLNDEKDWTFVGTSRTCEYEVTKLKE
LAAIEFRVCAKNEKGQGDFMQIGPIIVKDFIIPPHADLSEYPGGQISVRIGHNVHIELPY
IGKPRPTVEWLKDNLPLKESEQVRFKKTADKVTLMIKNVRKKNGGKYTLILDNKFCRKSF
CIKVVTLGPPAKPTGPIEMDEIRAESITISWDEPSDDGGGEIICYSVEKCDNSQTDWKMV
CSNVTGTTYKVPNLVKGTGYQFRVCAENRYGVSEPLISQTVLAKHQYRPPSPPGKPVVYN
IMHDSMTIRWDAPINDGGSAIIGYHVDKKEKNSIMWQKVNTVIIKDTNYRIIGLIEGLEY
QFRVYAQNDSGISKVSEASKLTTAVSPVDPPGLPDYIDVTSDSITLKWDAPKNDGGSKIV
AYYVEKRQDQGRWLKCNFIDVSECQFTVTGLRSGDRYEFRVIARNAIGTISPPSQSSGYI
LVRDESIAPNIEFGKEYFEGLTVRAGDNIRLKAIITGRPAPQVTWFKGRKEIDKKTMIDI
TTVTGSSSLFIRDADRNHCGIYSVEAKNISGRKKQDITVKVLDVPGEPIGPITFTHISEE
KATLSWNPPENDGCAPIKHYIIEKRDPSKILWTLVTDQCEVCTYTVTKLIKDNEYQFRVS
AVNKFGAGRPLESTPITAMMPFAVPDAPGAPEATSITGHSITLSWEIPSSDGGNEIKYYI
LEKREKKNMRWMKILSKKPITEPTYTVTNLTEGCLYEFHVMATNDAGIGPASNASALIKC
STPTSTPSAPTVLKATDSTKTSVSLEWTTPVFSGGMEITGYIIEMCKVNSQEWQKINVEN
CTKTKYTATGLDSNEEYKFRVCAVNGVGKGEACEILEPVRTVDRLASPEIDIDASFKQTH
IVRNGGTVRLYAAFKGKPPPVATWTKADGDFSVMVDINTTEDYSTLIIENSNRYDSGKYI
LSLENSSGSQSITFNVKVLDTPGPPGPIKFTDVTKGALTLMWNAPVNDGGAHIQNYIVEK
REASRRTWQEVSSKCTHETLRVTELLEGMPYFFRVLAENQFGRGEAYEMSDPVIATAEPA
PPKTLNIVDTTNSTATLAWLKPEHDGGSRITGYMVETKVKGSEKWVASGHTKNLSMVLEG
LQENMEYEFRVKAKNDAGYSKPRDASSSVIIKEPHIEPTADLSGITNQLITCKSGSTFTV
DVPISGRPAPKVTWKLEEMRLKDTERVSIKTSKNRTTLSVKDCMRGDGGKYFLILENITG
SKTFTITVNVIGRPSAPSGPIQVSSISSESCVLTWEAPEDDGGTEITNYIVEKRESGSGA
WQLVNSSVRHTTIRVTHLTKYMHYTFRVSAENRFGVSKPSESETIVAEHPFVPSSPPTRP
DIVSVTANTISICWEEPYNDGGSKVTGYWIEKKERNTILWVRDNKIPCFECSYKVTDLIE
GLEYQFRVYAMNAAGLSKPSEASRRVVAQNPVDPPTKPEVMDVTGFTVSMKWSTPLNNGG
SQIVGYIVERKPYSPTGDGRWLKCNYTNITDTNFTVTGLGEGEVYEFHVIAKNANGIYSM
PSESTGPVTCRAEYSLPVAELDSKLLADTVTIRAGSDLVLDAAIGGKPEPKAVWAKGDKE
LELCEKYSLQYTNARAMAIIKFCDRNDSGKYILTVKNSSGVKTIAVNVKVLDTPGPCHGK
ITIAGVSEEKCTISWQEPLEDGGDPVSHYIVERRDTNRLNWVTMEAECKTLSCVIAMIKN
SEYIFRVRGVNKYGPGVPLQSEPVVARNTFTIPSPPGAPEIIAVGKDFATIQWLRPESDG
GNEISNYLVEKRERKTARWSRVNKDFTIRDISFKITGLREGCVYQFRVTAVNAAGESEPS
DTSLSVFCREPTYTPDSPSIPRVADTSKDTISLVWTRPVEDGGADVIGYILEFQEEGTEQ
WGKAHEKIIRNTEYTVTGLNNNKKYSFRVAAVNINGTGKFSNPCGEIEPLERTEIPDLEL
DYNLKKTVSLRAGGCLRLFVTVTGRPFPVIRWSKSDVDLQNRAFIEVNDSCTTLIIDKVN
RYDAGHYTVEAENPSGKKSASISVIIYDSPGPPGLLKIMDLSKDSAFITWDAPSVDGGAP
VTNYIIERREASMRAYKTVTSKCSKTSYKVTGLTEGMLYYFRVMPENIYGIGEPRETSDA
VIVCEMPMVPQKLEVVDVTKSTVTLSWEKPLHDGGSRLTGYVIEACRFGTEKWMKVATLK
TSDFQHTIISLNENEQYLFRIRAVNSRGVSEPREIVTPITVQELQVLPKIDLSGITQTVN
VPVGKPIELHIPISGRPPPVCSWYFENVKMRAHNRVKIDTTRKYSKLTVCDSTIDDTGEY
MLEVKNFVGTATETIKVVILDKPDIPKGPIRIEDIDATSVTISWDPPERDGGAPISGYVI
EQRDAHRPGWLNVSETVSRPTFKFTRLTEGGEYVFRVAATNRFGTGSFIQSDVVLCKSDK
TIPGAPGRPEVFDVSRDGMTIAWLPPEDDGGFEVSGYIIERKEVRSDRWVRANKNPVTMT
KYRSTGLTEGLEYEHRVMAINSRGTGKPSLISKPAVATDPIDPPGSPQNPRVTDTTRTSV
SLAWSPPDEEGGLKVTGYLIEMQKVGTYQWIKCNTTPSLICEYTLTQMPQEGEFKFRVMA
CNAGGTGEPAEVPGTVKVTEMQESPDYDLEMKHKEGFVVRHGGVIRLSIPIKGKPRPTCK
WTKDGQDIFHRAIIATSEELSELVIKEAQREDTGIYKLHLENKCGKKEACIKVKVIGPPH
PPEGPLKIDDIKAHSIRVTWKPPLEDGGSEILGYIVERQDVPKTAWYTVDSRVVDTSVVV
KGLKENAQYHIKVTAENQFGMSKCLKSDEVITPKTHLCPPEPPSNPPEILDVTKNSVAVS
WSRPKEDGGSRITGYYVEYREISTEMWMRYETEFTATVCTVTRLMPEKEYQFRVIAKNEI
GESEPGPTSELVLCKDPFNKPSQPGEIQTVNVTKDCISIRWERPKCDGGKEILGYWVEYR
KTGESTWKKCNTERSKDTNLTMGGLLEATEYEFRVFAENATGVSRPQRTAVGIKTKPSVL
HKPSLRKEMEDAITKLGQPCMLKCQIIGRPLPMIKWYRFGKELVQSCKYEMSSDDRNHSL
TITVNQQEDEGIYTCSAVNEAGEVQTSGKIILEAAPQLHPEYPLKEKYYPGCGTSFRLHV
MYIGRPVPQITWFYNNISLQLSENIIIENTEYYTHLIIKNVQRKINAGRYKVHFSNTFGT
FEKEFYVEIQDKPAIPEGPIVIDALLKNSVIISWKAPIDDGGAMITNYIVEKREDKEDEQ
WNLVSSSIFGQSCRITNLVEGAGYFFRVSAQNRYGISNPLEIQSVIIIKGQLEKPGIPQQ
IVVTGVTKDSCVVSWKPPINDGGSKIKNYCLEKCETNQNEWIPVTNDEIHQTVYSVKRLK
EGLEYKFRVKCENLWGDSEWSDVSAPVALKSDVEIRAPAFKEDLRNMSVKYKSTATFVCR
ISGQPKPVVKWYKCGKEIQPDGQKITVQELKGGYYQMVIAAADEEDSTVYQVRATNQGGS
IAATASLDVEVPAKIHLPKHMQNKEAVSALRGEVVSIKIPFSGKPDPVITWQKGQDLIDN
NGYYQVIVTRSFTSLVFPNGVDRKDTGFYIVCAKNRFGIDQQRIELDVADVPDPPRGIKV
SDVSKDSVCLNWCAPANDGGSKVTNYIVEMCATTAERWIRVAQARDTHYTVINLFGKTSY
QFRVIAENKFGQSEPSEPTNPVVTKEDKLRVLNYDEEVSDSREVSKGKVPHSDTKNVHNK
YVIAEELGHGEFGIVHRCIETSSQKTFMAKFVKVKGADQALIRKEITTLNVAQHMNFLCL
HESFESPEELVMIYDFISGVDIFERISIANFELTEWEIVRYIRQVCEALEFLHSKNYGHF
DIKPENIVFTTRSGYNIKIIEIGQARYLTPGDNLRIQFTTAEYCAPEIHQCDMVSTVTDM
WSVGVLVYVLLSGLNPFTAETNQQMIEHISKAEYSFDDETFKSASLEALDFVDRLLTKER
KHRMTATEALRHPWLKMNKEQIGTKAIKTTRHKRYHQMLIKKESNVVVSAARVAYGGAIR
SQRGVTVAKVKIAPFEHGPLAGQINHLVAEEGEHVKFTCHIENYDSSTEVTWYCGVRQIE
EGDKYEMKYEEGVAVLHVKDIARADDGTYRCKVLNEYGEDSAYAELFVKNVRSYHDFFFK
RTVKKLKRRVDTERLLERPPEFTLPLFNRTAYIGENVCFSVTITVHPEPRVTWLKSGQKL
IPEDNDKKYRFISDKGRYQLIIHNVQPEDDAEYTVVARNRFGDDNCKAHLTITAHPAPAD
KTIRPMFKRLLANSECKEGQNVRFEIRVSGSPVLKWEKDGLPLAFGPHMEVIHEGLDYYA
LLIGSTLPEDSGTYRITATNSAGSASCQAILRVQRATHVMKEYEGAGQKIKQPEKTGIDK
KVRLSQILSGTEVSPLTSVAQEALREAAIMYKPTMPTKKIVSEITDKKEKEEKCKRTEEK
RLQMPYDIPAPQIHSQSAIVEDMEIKHFVPFSDMKWYKKLRDEYKMPERMEKHAQKRLKR
IRLSRWDQFYVVPLPRIKDQYKYKWRIPKFSQDDLEIVRPARHRTLSPEMVAYYKERRRS
LSDLSDEKVLLPVQDYLSWKRTEEERLRLEEELQLGFSASTSSFSPIHFELSALAHPVSR
EMHYDKEVVVKQHDYHIPSKYEAGPSLTDLRLRHDTVTYKPPRQKQRVHEDMEDQKLLCP
IATSQRLASYQSQLKFMEYEEKLRVSSKEKHAAHVSSKAKEGEEATEYTAISFPPTVHDM
KSRMSLSPAHSQMVHSISEQKASPYAHPTTMTKSEKTHKTLPTPEITVPYTVSTENLTSR
HEKLESLDIMARYEARKAALKSERKYEVVTQQPFSLDHAPHITVRMHSHRVPCGQNTKFT
LNVQAKPNAEIKWYHNGQKIQESRKFKFSNISGVLSLQVFDCQAEDSGTYRVVCTNTKGE
ATDYATLEVSEGGYSIYSSQRKDDDPPVSLVPEMIKTDDYQTSSIKATLSSETQMQVKET
QSKLAEKCERSMYAEHTASKKKIKDSKVSVLEEESVQEQLKTTLPAKIVTKPQSLTVVEG
QSAKFTCDVDGIPTPTVTWIQEGEIIVSSQRHHVITTQYKSTFEIFSVQLSDEGSYTLVV
ENSGGKQEVQFSLTISRSSPKDKISASPTKVKSSEPTEKSSESTGIIPLETHVMSPEVIK
FSPKVKSPEPATSSQRDKSPALADSPTPQKIEMPKTMDELKVEASGGKVSITCVADSNLN
RVIWFKDGNKLIQDSRHHFHTSSDGTCTLSILGIAKSDEGEYACEVVSEKGVSRASFSFV
GRVFESIYSKMTNFTEPEKQGHDIKFNSFPLKQDLSAGSTDVKELQLQTKKEAYTGSCKK
PETTEQIVEKMLQDEVQPCTEMKTFHHQLSMAEGKSITLKANIPNASTVRWTLNGEELLN
SGEYRYGVSGNDHTLTIKNVSQHEEGIITCEAKTEEGIVKCQFDTTVTSKRANAPSFLVQ
PKSQNVNEGQNVIFTCEITGDPTPEIEWLKNNVLVCLSSKLKLSRSKNVYTLEIKEASIS
DSGKYTVKAKNMYGQCSATASLNVLALVEEPTKMIVLEKSATAASVHEGFSTKAVHMATS
MQEASFRSSSMAEVKIESMSATSMSSMTSESMVAMSSSSRMEMSSHSHIEGSSLRTIKHS
HQGSPAKIEALPEDICIEKGKVLTISCAFSGDPVPEIEWTRSGRTLPSAEDSGRFHVETA
EDLTTLIITNVKEKDAGAYTLKLSNELGSDTATVNISIH
NT seq 94260 nt NT seq  +upstreamnt  +downstreamnt
atgacaacacaagcaccaacattcacacagccactgcaaagcgttgcggcacttgagggt
agtgccgcaaagtttgtggctgaagtcagtggtgttccagttcctgaggtgagctggttt
cgtgatggccaggttctttccgctgctgctctgcccggcatacagatctcgttcagcgaa
ggccgcgctgtactgatgatccctgccgtgacagctgcacacagtggacgattttccgta
cgagccaccaatggtgccggacaagccactagcactgccgaactgcttgttacagcggaa
actgcgcctcccaacttcattcagagactacagagtatgaccgtgagacaaggaagcaga
gtgagactggatgttcgcgttacgggaatccctacacctgtggtgaagttctacagggag
ggcgctgagattcagagctccgccgacttccagatccttcacgagggcgaccgttacagt
ctgctgatcgctgaggcttttcccgaggattctggaacgtactctgtcagcgccaccaac
agcagcggccgcgctacttctactgctgaactgctcatccaaggggaagaagtagctgtc
cctgctaaaaagacaaagacaattctatgtactgctcagacttctcagactcgtcaggca
cgtgttgaaaacagagaagaagctcattatcaggttgctgcagctatgatggagatacat
gtggaagaaggtgctgttgctgaacacctgcgacacaagacccccccacttgtccgcaca
aagccaacttcgaagtctccaacttccacactagtgtcgaaagtagcaggcacacgtcaa
cagtcaccttctcctgtcaggcatgtcaaggcacctactccaacgcctgtgaggtctgtg
tctccttctacaagactatcagtgtcccctatcagacctgttaaatctccagtaatgacc
cgaaaacagcccactccaagtactgatgtcctccctccctggaagcaggaggactatgtg
gctgagtccgacatgattgtgtgtgtccagagctctgcgacacgtattcagatggagcaa
cgctttgaaggctcctatggggcacagcagcaaggtcaacatgaggatggcaaaatgatt
gctgtagctacagtggtagctgcagtggaccaagccaggggccgagagccttgctctgat
tccagagaatggagcagcacagaaagaagtattgatactatgcaattatatcctgaaaag
gagcaggctgagggagggaaaaaggcagaggcggtggccacagtgcttgctgctgttgac
ctagcgcgcattcgaaagcctgcacaggccgagggggttcgaactgaagaggagatcgta
gagcgtgacttaaaacagcaggccctgaccaaacagatctccaaacagcaagtcacaact
gtaacaatgaaaactgaggctgttcaaacaccccctcctattgtccttgctgaagacagt
gtcagtgtttctcagatcaagagaagtaaggaaactcccatccatgtggaccctgcgctt
gcaccatccccaagtcctcatttcacagtttctaaagttactgttcctaaacatgatcat
agttatgaggtctcaatagcaggttctgctattgctacacttcagaaagagttatcctct
actactgcttctcaaaagatcatcaggcctgtgaagcctccttctcataagattgtggag
accagagtgatgtcagaaccagtcctgccaccatttagagataccagtgagagatatcag
gcatctttcaccacatccatgcagaaagggatagggctttcttttacaggaggaatggag
caaacacatgtccagttggagaaagaggtggttgaagctgcagcagtcccctcacctgca
caagaagctgtggttcctcccactcttgtagtcggtttgaagaatgtgactgtcactgag
ggagaatcggtgactctggagtgccagatatccggtcacccagctccaagcatcatgtgg
tttcgtgaggactatagaattgagagttcgatagacttccagatcacttatgaaaatgga
tatgctcgtctggttatccgggaggcctttgcagaggacagtggtcgctttacttgcaca
gctaccagcgaagctggaactgtcagcacttcctgttacttgcttgtgaaggtgtcagag
gagattgagagcagagaggaaataatcactgctgtctctgcacacatggaaactgtagag
gagaaacgcattagtactgaagtcaaagaagaaatattagaagtgcctgctagtgcagaa
gctgtggcacctttcttcgtgaggaaacccacagtgcagaagcttgtggaaggtggcagc
gtcatctttgaatgtcagataggtggtagtcccaagcctcacatttactggaagaaagct
ggagttccccttacgactggatacaggtatagagtaacctacaataaggaaacgggcgag
tgcaaactggagatttccatgacctttgctgatgatgcaggagaatattctatctgtgcc
aggaatcagctgggagaggtctctgcatcagccagtttacttgaggaagaggaatatgaa
gcctacatgaagatgcatgaaatgactataatgactgaaggaatcatcatggtgcaagaa
cctagagtagcagacgtccctccagtggtcatgaccgaatatgagagggaacagattctt
atgcagaagaggatgacgcagcagacacagatgctgaagacatttgtaactgaacaggaa
ttccaaatctctgcttttgaggagaggataatccgtgagattgagctccgcattctgaag
attacttaccaggtgttagtaaccgaagatggggaggagatggtcatgagtgtagctgaa
cacgaagctgtcgagccagtctttgacacccctgtaaagaattacaggattttggaggga
atgggagttactttccactgcaaagtgtcaggaaatcctttgcctaagattgcttggtac
aaagatggcaagcgcatcatacatgggggacgttatcagatggaggttctacaggatggg
agagccagtctccgaattcctgtcctgctgccagaggatgaaggtgtctacactgctttt
gctaccaacatgaaggcaaatgcagtcagctctggaaaactgtatgtggaacccactact
gtagttggagctcaaccatacttccctcagccagaggccatcaggataagaagatctact
tctcctcgttctgcaagttactctcctggacgttctcctggtcgctctcctgctcgcagg
ctggatgaaacagatgagagccaactggaaaaattgtacaaacctgtatttgttatgaag
cctttctctttcaagtgtttagaaggaaaaactgccagatttgacttgaaagttgttggt
cgacccatgcctgaaactttctggttccataaaggccagcaaatagtgaatgactacacc
cacaagatagtggtgaaggaagatggaactcagtcactaattgttgtccctgctatgcca
tacgactctggagagtggactgtggttgctcaaaacagagctggaaaggcctctgtatca
gtaacccttactgtggatgctaaggaagacttggtgagacctcagtttattgagaagctg
aaaaacattagtgttaaggaaggcactttggttgagctggctgtcaaagctattggaaat
cctcttcctgagattgtgtggttgaaaaacagtgacatcatttccccacaaaaacaccct
catattaggattgaaggggccaaaggggtagctcatttcaagattgcatcaacaactagc
tccgatagtgcttggtacacagccacagcagtcaacaaggctgggcgagacactacccgg
tgcagggtcaatgtggaggtagagtttgctgaaccagaaccagagagaaagcttatcatt
ccaaaaggaacatacaaagccaaggagattgctgcaccagagctagaacccctgcacctc
cgctatggtcaagagcagtgggaggaaggtgatctgtatgacaaggaaaaacagcagaag
ccacacttcaagaagaaactcacatcagtccggctgaagcgatttggccctgtacacttt
gagtgcaggcttacacctattggtgatcctacaatggtggtggaatggcttcatgatggc
aaacccctggaggctgccaataggctccgcatgataaatgagtttggttactgcagtctc
gactatgaagtggcatatgccagagatagtggtgttgttacttgtagagcaacaaataag
tatggagttgaccaaacttctgctaccttaattgtgaaggatgaaaaaggccttgtggag
gagactcaactaccggagggtcggaagggaatgcagaggattgaagagatggaacgtttg
gcccatgaaggtgctcttgctggagtcacagctgaggagatttctgagaagaccaaacca
gagattgtactggttcctgaacctgcacgggtattggagggtgagacagcaaggttccgt
tgcagggtgactggttaccccacacctaaggttaactggtaccttaatggacaactaatc
cgtaaaagcaagcggtttaggctccgatatgatggtatttactaccttgagattactgac
agcaaatcttatgattctggagagatcaaagttgtggcagaaaaccctgaaggtgtgagt
gagcattgtgtgaagctagaaatccaacagagagaggattttagatccatacttcgccgt
gcccctgaattgaaagctcctgaatctgggacttctccagatcgtggcagagtgtccttt
gaagttcaaaaggttgacaagcctgttgacactactcagcctaaagagataattaagcta
aggaaagcagagagagttgttcatgaaaaatccacagaagagacggaggagctgagaagt
aaatttaagcgtcgcacagaggagggctattatgaagcaatcactgctgttgagttcaag
tcttgtaaacgagatgattcctatgaggaactgctgaagaaaacaaaagaggaacttctt
cattggaccaaagatgtccctgaagaagaaaagaaaaaggaagaggaaagagggaaagtg
actattccaaagattaaaccagagagagttgagttatctcctagcatggaagctccaaag
atcatggaacgcatccagagccagaccgtttcccagactgatgaagtccgcttccgtgtc
agagtggttggtaaacctgatccagaatgtcagtggttcaagaatggtgttctcctagag
aagtctgaccgtatttactggtactggcccgaagacaatgtgtgtgaattagtaataaga
gatgtctcagctgaagactctgctagcattatggtcaaagctatcaacattgctggggaa
gcttcaagtcatgcatttcttctggttcaagccaagcaagctgttgtctttactcaagaa
cttgaagatatcattgccaaagagaaggacaccatggtaacatttgaatgtgaaaccagt
gagcccttcgtaaaagtaaagtggctgaagaacaacatggagattttctctggtgataaa
tatagaatgcactctgacaggaaggtgcatttcctctctgtactgatgattgaaatgaag
gacattgcagaatacacttgttgtgttgttgaagatgaccatattagaactactgcgaaa
ctcactgttgagggtgctcccctggacattctgacagcgctggagaatatagaggttcct
gagacctactctggagagtttgagtgtgaagtatctcgtgaagatgctgagggtacctgg
tattttgagggaaaggagatcactcccagtagcaaatatgttatgtcatctcgtcgagga
cgccattctctttgtgtaagagacgtgaaaaaggaggaccagggaaaatacagttttgtt
gttggtgacttgaagacagctgcctccttgacgatgaaattgcgacctgttacgttgatg
caaggcctatcggacctttccgtctgtgaaggtgacatcgtacaactggaagtaaagttc
tcccaggaaaatgttgaaggcatctggatgagaagtggccaagccatcttggccactgat
cgcattcacattgtcattgacaagcttgttcacaaacttcttattgaagatgcccaaagg
agtgatgctgggatgtactctttttttgttcctgctcaggacataacttcttctgcaaag
cttactgttcagtctattggtatcttgacaccgcttaaagatgtgacctcagttgaaggc
actaaagctgtgcttgaggctaaaatctctgcagcagatatcagctcagtaaaatggtat
cataatgacaagctgattgtgccaagcgagagggttcagtttgttgctaaagggtcgaaa
cagcgattggtctttagcagaacgtttgcctcagatgaaggatgctataagctggttgtt
ggcaaagctgagaccagctgcaatttaacaattgagaaaattgagattttgaagcaaatg
gaggaccagatgtgcaccgaaacccaaaacgtcacttttgaagtagacttgtctcactct
ggtattgatgctgtgtggaccttcaaaaatcagactcttaaagcaggagccaagtacaag
atggaggccaagggcaagcgctataccttgactgtcataaacacaatgaaggatgaagaa
gggctgtatacctttgcagctggtgaaaagacaacaagtgcaaggctaagtgtaacaggt
ggtgctgttaaaagacctctccaagatgtgactgtagcggagtcccagactgctgagttg
gagtgtgaggttgccaaccccactgctgagggcaaatggctgaaggatggccatcctgta
gaattcagtgacaacatcaggagtgaggaatttggagctgttagaaagcttgtgatcatc
attacaagacctcaggacattggggaatacacttaccaggttgcaaattctacaactaca
ggcaacctgaaagttgaagctgtgaaagtaaagaagacactgaagaaccagactgtaact
gagacccaggagacagttttcagtcttgaactcacccatgagaatgttaaggggtcacag
tggattaagaatggtgtagagatccgccccagtgacaaatatgagatcagagtagatggc
atggtccacagcctgaagatcaagaactgcacaacacaagatgagtctgtctatggattc
aaacttggaaggctctctgcaaatgcaaggcttaatgttgagacaattaagattgtgaag
aagccaaaggatgtgacctctctcgaggatagtacagcctcctttgagctaagtctgtct
catgacaacattccagtgacatggatgtttaacagtgttgagctgaagcccagtgaaaac
tgtaagattctgtctgagagaaaggctcacaagctgataattcagaatgtgaacaaacac
aatgctggagaatacacggccatcattgggcacttgcagtgcagtgccactttatatgtt
gaatccttacggatcacaaaaaccatgaagaatattgaggtccccgaaacccaggtggct
agctttgaatgtgaagtgtcacacttcaatgtcccatccacttggctgaaaaatggagtg
gaaattgagatgagtgagaaattcagaattgtagtacagggaaaacttcaccagctcaag
ataatgaacaccagcagagaagattcagcagaatacactttcatctgtggaaatgacaaa
gtttctgccactctaacagtcaatcccattttgatcacgtccatgctcaaagacctcaat
gctcaggagagggacacaatcacctttgaggtgaatgtaaactatgaaggaataacttat
aaatggttgaagaatggtgtagagatccgttccacagagagatgccatattcgttctaaa
caacttactcactcactgaccatacggaatgtacactttggagatgttggagaataccag
tttgttgctggatctgcagcaacttcagccaacctatatgttgacgcgcgtgttattcaa
attacaaagcacatcaaagatatcaaagtaatagagaagaagaaggctgtttttgaatgt
gaagtttctgagccaaatatccaagtgacatggatgaaagatggacaggagttggaatta
tctgaccggtacaaggtttctactgaaaaatacctgcacaggctgatgatccagactgtc
cgtttgtctgatgctggagagtactgtgtggtagctggttctagtacttctaaggctcag
ctcactgtggagggccgtgatgtccggatcacagatcttgtggagaaagagattactgtt
gttgaaaagcagagggcaacatttgagtttgaagtcaacgaagatgaaattgaaggccgt
tggctgagaaatggcattgagattaatttttcagttgaagagcggttcaactatgtagcc
atcagaaaaattcatcgtttaaccatctctgaaacatatcgcagtgatgctggagagtac
acatttattgctggcaggaacagaagcatggttacactccatgtcaacatacctgagcca
ccacagattattcagcacatgaagccccagtctgttgaggctggcaaacctgcccggttc
tccgtagtcgtgacaggcgttcctcagccacaggtgttctggtacaaaaactcccagatc
ctgtcttctgggttcaagtgcaagttcttacaagatgggaatgagtacacactacttctc
gttgaagccttccctgaggatgcagcagtctacagctgtgaggctaaaaatgaatctggt
gaagacacaagcagtgccactttagatgttaaagttcctgagatggtttctcctgatacc
gggactcctctctctcctcctgttgtcatatctcccatttgcaacacctctgccaaagaa
ggcgagtctgctcgcttccagtgctgtgtctctggaaaagacctggagatcacttggtac
agcaaagacaaggagatcaagcagtccagcaccataagaatgtctcagtttgatgataac
taccagctggaacttgccagagtttactgtgtggatgcaggagagtacacttacgtggcc
agaaattctgctggaatggtgtcttgctctgcagttttgaccattgatggacaaacagag
gatagcacatccaagtttctgtattatgattcaacaaatctttcaacaagtgcagtaaat
gtaaaacagaaggctattggtcaaaagcccactttcattaaacctatcatgagttgtact
gtgtcccatggggaagttgcaagattccatgcttgtgtgtttggaatgccaaagccagac
atcagctggtttcataatcatgagctgatgaaaccaactaaaaatgttgtctttcatttt
gatgaaatgacaaacattgccacactaattatagtagatgctttctttgagcatgctgga
cagtacacttgcaaagctaccaatgctgctggagtggcggtttgcacagcaacccttgct
gttaccaaagaagacatgaaaactgagacagagttggaaactgaggatgtggaagatttt
ttgaaactgaccatcacaaaagaagaagaagaacaggaatatcacagtagcagcttagag
tttactgaaaaaaccaaaatacttgaactcaagccagagtccaaaatcttttctagcacc
ttagcaaacaaaaatgaaggacccgtttttgttagccagctttcatctgcacatgccagt
gttggagagatggttaaatttactgtcacagtttctggcatcccaaaacctaatattcag
tggtttcacaatgggagggctattacatcttcatcagtttacacatttgttcaagagaag
gatgagtacaatttaattatttcacaggtgaagactgagtatgaaggcgaatactcttgt
actgccagcaacaggtctggtcaggcaactagcaaagcttttttatatgtggaagtgaaa
gaactagaacactgtgttggggaaaaatttgaagtaactggacaaccccctcttttttct
gtgcctattaaaacaattttgtgcactgaaggaagtcaggctgattttcagtacaaacta
actgggaatccttatccagaggtaaaatggttcagagaaagattccaaattcaacctagc
aagcgcttcaaactactgagtaatccagatggttttagctccttaaacattaaagacctg
aaggtggaagacagtggcatctatacatgcagagcgtcaaatccttctggggagtcctcc
tgcagtgcggaactggttgttttccacaagctagtgtctcaccagcacaaggacatgact
gttacaaagcagcacagttacaaagcctctaaaactgaagaagccactgaatcccgtctg
tacatggtgcatctacctggagaggccagagctagccttcagtctggacaaaagctagtg
tacactattggtactgagaaccggaggacaatagctagtgaacaggtggactccttgcga
gagattgatgtatctgttgcaactcttcacaaagagcgggttactcaacaagctgcagtg
ctgcagtcaaaaaatgtggaagagggagttactgtggcccctgcccagcctcttccttct
gcactagccccaatacaacagtttcatgcaacctcatttgcctctgcagttcaggagtgc
cagggtttcagagaacaacacgttgatcacattgagagccctgaggccatagagcttcag
gtaacttgggaaaaaccctcaaagatcatgtctgctgttgctgaggaagttacacccttg
agtagtacaacagagattttaagtgaagggaaaacaaagaaaatggagtcaactccagag
ccaagacattgtgttagcagtcatcatgaagaaaccaggctttatattgtggatgagggt
tcagagattattccaatgcctgaggtggaaaaaagctacaatgtcaaagaaggtgttaag
atactgtattctgctacatctacagagaaacagcagttttctgaagctcatgtaacagag
ttatccatttcagagtctaccacttcttcagctattaaagaggagttaaagcctgctcaa
gcatccatcactgaaaaaaaatattttttatctaaagaggagacgtttgatgtgcatagg
ctgaaagaagagaaggccataaaatgtaaggatactaatcttaagtcatgtctgactact
gaagaaagacaggagctccaagctgaaaaaactaaacaaatacctgatttagaaagtgcc
gtgtgtctctcatttcaagaggaagggaaacaggccctgcatttgcaagttatacaagat
cagaatgtactaccgtctgagggcagattcatttgtaaaaaaccagtggctgaaaaaact
gatattataaaaagcccgcctcttttgtacacagtaactatggatgaacagaaatctatc
tcatatgaagagtcgtctaagttttattcagaggaaagaactttttctgttcaggcaata
aaagagaaacctgccacatttcatcttcagtccattgaagtagagtgtatattacctaaa
gaggacatacttaaagctgaaaaacctgagcagcaaatagcagttgagaagctggaaaaa
gtgcgcaaacaagcagtaacagctgaagaaaaaagggaattgacagctgatttttcagaa
gatattgatagctcagtgataggggtttacccagagcataaaaaagaacgaaaacctcaa
aatatcctccaggttatttcagaaccaatgcagttacctaaggaaagtcctttcaccact
gatgtgaaacagcaacgtgcattagttcagaaggaggatcgctggaacattatgcactta
atgacaacagaggacaataaaactcttgaagagggacacactgatattctaagtgttgta
gagaaatgtaattgtcaagctaaatttgagtcaaaaatcccaacggagctagtttacatt
gaggagaaggcaatctcaaccgaaagcagcattgttctggacgcagcagaacaagatttt
gccactcaaattcaggaaggacagtctgtaagaaaatctatattgatggaagagaagcaa
ataataattggtgaaaaatctcaagaattacaaaaatcagatacaaatacagtctgtatg
ataatgcagccaaaacaagccttaaaggtgcatgagtcacaagaaagtcagacactacca
aaggaacttacttttattattcagacaccaaaatcattcagcctggacatcaaacagcag
ctaaagaatgcactgcagtctgctgtagcacaagaacagccactgctactagctgaagtt
gttcaaagtttggatactgtggaagtaaaggaagttaagatatgcaaagaacctaaatat
acaacctttacgtaccttgtcataacaagcggtgcacctttggaagtaactatcgctttt
gatggcgattaccctcagactgctgatttaaagagtgagcttcaggcagctttttgttct
cttatctatcaggaacagcatgttatgagttcagaaaagcctggaataaagcaaatagat
aggccagacaggctacaggtaagtggaacatcttccgaagaagttctacccactgtggtg
aaagctgttacatgtgcagaaaatgttacagagtttacgtcacccaaagttcagttggcc
gcactgaagactgaatctcaagctgcctttcaaagtgttaaagtctgggacaaaactaca
atacaagaatcacgggaaaacgtatccacacttacagagagtattaaggtaataaagacc
actgcagaagaatataaagaatcagtgcagatgaataggcaagaacagaaaactgtgaca
gtaaaaggccagcagatagatggtgggggagcacattcatattctgacatatctccggca
caaattccgatacacttgtctagagttgacgtgcaaaaagaaggtgttgaacaatttgcc
aaagattatccagttatagaaacatttctggaagacaaagctgtggatgagcatagtaca
gttactttctctgtaacaattagatgtgttaaacaagtcaattggttttttaatggaaaa
ttggctaagtctggcaaagagttcaagtgttccaaggaccatgatacttacacactcgta
atcaacaaggttatcaaggagaagcacgaaggagaatatgtctgtgaggcagtgaacgaa
gctggcaagacttcaacatcgtcaaagctcacagttgttttaagagtggcacctgttttt
aagcacaaaatccaacctttggaagtcagtgttggcaatcgtgccaagtttgagtgtgag
atagaggaagcacccaacgtgaaattcaagtggtataaggctggcatcgaggtgagagag
agtgagaagtgcaagatcttcagtcatcacctgaccacctcgatggaacttttaaaccta
accaaagctgacactggagaatatacatgtaaagctacaaatcaacatgggagtgacagt
tgttcagctttcctgaatgtgtctgaagttttcccaccagtttttactaccaagcctgaa
ccaatgacattatatgtgggaaaacaagccagcattcagtgcgtagttactggctctaca
ccactgagtgttgtgtggcaaaaggacaatgtttccatttcttcgggagaaaactaccgt
gcatctgtggacaagaacagatatacacttgaaattgtcaaacttcaagttgctgatcag
ggcacttacatttgcaaagcatcaaatattgttggaacggacatgtgttgcacagaactg
agtgtaattgacaagcccagttttgtaaaaaccttgacaccaatgacagtagctgtgggc
aacccgctacgcctcgagtgccaggtagatgaagacacaggagtgggtatcacttggacc
agggatggcaggaaattgcataactctatggatcttaaacttacatttgaggacaagatt
gtagctcttgagattccacatgcaaagcttaaagacacagggacatacacctgtacagct
gcaaatgatgcaggaagcagtagctgctcttcgacaataactgtccaagaacccccaacc
ttccttaagagattggaacccaagatcctgtggaaacagggtgctacggcacgaatgcag
tgcactgttaagggctcacctgagctccatgtcacctggtttatgaatgacaaagagctg
accactggagagaagcacaaaatcacattcaaagatggtcaagccaccctagaaatgtct
catcttactgtggctgacagtggacattatacgtgtgaagtgttaaatgaagctggttgt
gaaagctgcagtagttctgtaactgtaaaagaacctccttctttcaaaaaggaattacag
acagtagaagtagtaaaggggaccactgctttatttgaatgtgaagtaagtggcacagct
ccatttgaagtgagctggtataagaacaagaaaccaatttcctctgataaaaagtataaa
attgtatgtcaggacaacatagcaactttggaggttaattcatttgaaagtgcagatatc
ggggattaccagtgcgttgtatcaaatgatgttggtaaaatctcctgcaagtcaacaggc
agattaaaagagccaccttcattcttcaagaaaattgaaaacacttctgccattttggga
aattctgttagactacaaggaagtctaaaaggttcagccccaatcactgtcaaatggcta
aaggattctgaaattctgagtgctgaagatgatgccaatgtaacaatgacatttgagaat
aatgttgctgttcttgctataaaaacggtgaacgtaacacacagtggcaaatatacttgc
caagctgaaaacgaggctgggaaacagcaatgtgaagctactttgtcagttgaagaacct
gctcaaattgtggataaaacaccatctgttagcgtgactgcaggtgagccggtgacttta
gagtgcacggtgtcaggaagcccagaactcaaagtgaaatggttccgagatggcaaggag
atgactgcaagccggaagtataaaatgatgtttaaggacaatgtagcagttttgaaaatt
cttgcagcagaaaaaggagacagctgtgaatacacagtagaagtggcaaatcgtgttggc
aaagatcagtgctcgtgttctgttactgtgttagatcgaatcattccgccatcattcaca
aaaaatcttaaaaaaattgatggaaatattggcatgaatgtcagtatggagtgcaaagtt
tctgggtctcagcccataacgatttcgtggtacaaggatgagaaagaaataaaagccagc
gcgaaataccagatggatttcaaagagaatacagcagctttgggaatctttcagttagag
aagtctgatgcaggactgtatacctgtcgggcaacaaataccgcaggatacaaagaaacc
agtggaaccatgtctgtgaaagaacctccggctttcatcattaaacctgattcccaggat
gtaatcccgggatctaccgtgatcctaaaaagtgcttttaccggaacaccaccatttact
atcaaatggttcaaaggggatgaggaaatgtccaccggaggaacatgttttgtcaagaaa
gatgcatcttcaactttcatggaactgcactcggtgaaacccactgattcagataattac
acttgccaagtggccaatgatgctgggaaagtgacttgcaccgctatcttgtttgtgaaa
gaaccgccaaagttcgtaatgaagcttgagtcttccaaacttgtaaaaagtggaagtacg
attatcttggaatgcaaagtaactggcagtcccacaatcaaaattaagtggttcaagaat
gagactgaaatcacttctgatgataaataccaaatgaccttcagcaactcggtagctact
ctacagattgtcaagagcgctgttgatgacagtggccactacatttgtgaggcatctagt
gaagccggttgtgaccgatgtaactgtgtagttacagtcaaagaaccaccaacatttttg
aaagcctttgaatccaaagaagttgtgaaaggttctgatgttgtgttggaaggaaatatc
tcaggttcatctccttttgaagttacctggtatagagacaataagataataagaaatgat
aagaaacacaagataaacatatttgaagacgcagttgccctccagattctgaaatgtgaa
gtcggagatgttggaaattatcagtgcatagttacaaatgaagtaggagagtcttcttgc
gactgtcaggtggcattgaaagaacccccaagttttgtgcaaaaaatcgagaacataaat
tctgttgtaggcagtgaaataacaatgcagtgctctttgaagggatctttgccaattgct
attttgtggctaaaagatgatcgtgagcttaaagaagatgaaaacataaagtttttttat
gaggatcaaacagtacagctgcatatcacaaatattcaactaaaacatgaagggaagtac
atttgccaggcaaagaatgaagctggaagtcaaaaatgttctgcctcgttgattgttaaa
gaaccagctcacattactgaaaaagcaaagtctattagtgttacagctggggatccagcc
acactggagtgcagattttcaggaactaaagttcttaaagccaggtggcttaaagatggg
aaggagttgacaactggtcaaaagtacaaggttcatcacacagataagaattcaatgtta
aagattctttctgctgacaagagagatggtggagaatacatttttgagatttccaatgat
gttggtagcagcacttgtgaagctacagtcacagttttagatcaaataatcaagccatct
ttcacaaggaaactgaaatcagtagacagcattaaagggtcatttgcccatctggagtgc
ctgatctctggttctctccctataaatgtatgctggtacaaagataataaggagataaca
gctgatgacaagcacaaatgcactttctttgaaaacacagcatttctggagatcagccga
ctcgatagctcagactctggcagttacacatgcattgccaaaaatgaagctggcagtgac
cagtgctctggcacgttgtttgttaaagagccccctattattttagaaaagcctaactct
gctgatgtcttgcctggatcaagagtgcaattcagtgtactgtttagtggtactccacca
ctgaccattaagtggttcaaagacagtaaggagattttatccagctcccaatgtgccatt
cagaaggataatacctccagtttactggagttgttctttacgaagacatccgattctgga
gagtactcgtgtgaaatctgcaacgatgttggctctgaattttgccaagcagcgctcttt
gtgaaagagcctccaaaattcaccaagaaacccgagagaataacggtaacaaaaattgga
caaactgtgagatttgaatgccaggtggttggcacacctgaaatagacatctactggttt
aaagatggaaatgagatcagtcccagtgacaagtttaaaatgtcatatgagaactccttg
gtgagcttggagatattgtgtactgaaactaaagacagtggagtatattactgtgaggca
cgcaatgaagcaggtagtgaaagctgcagtatggagctgaaagtgaaagagccccctgct
tttgtacaggaattaacacctctcgaagtcgtaaacggctccgatgcctctttcaaatgc
caagttacaggcacgcctccgtttgaggtgtcttggcaaaaagatgctaaagaaatcaca
cctgacaaaaggcacatagttttacagagcaatggttttgtcagctttgcaatactgaaa
tgcgaggcattagatgttggtgactatcagtgtactgtcgcaaatgaggtgggaaaatgc
tcttgcgcagctgcgctgcgcacgaaagaaccgccatcattcgtgaagaagatccagaat
gttgctgttttcttgggaaaaacggctgaatttcagtgtgttgtggcgggttcacctcca
ctgactgtgcagtggcaaaaagatgaagactggcttgtggaagatgctaatattgaacag
aagtttgaggacaatactgcctctctaagaattatggcttgtgaggctagccatagtggg
agatacacttgtcaggtcacgaacgaggcagggcttgtgaagagctttgcgacccttgtg
gtgcaagaaccaccccagattacagaaaaacccgagatgataaatgtgacagctggcgat
cctgtcagtttcgaatgcaaagtgtctggcactccagagctcaaagtcagatggctaaaa
gatggaaaagagctgacatccagcagacactacaaactcagttttgaaaataatatcagt
agttttaaaattcagtctgcgcagactggtgatggtggagactatatgtttgaagttgct
aatgcctttggagtgtgccattgcaaagtcactttagttgtactagaacaaatcattgct
ccttccttcctcaaaccactgagggaaatgcatgaagttttgggatcttttgtgaaaatc
cagtgcacattctctggttctcttccaatttctgtcgaatggcagaaagatggtaatata
atttctgctggaacaaagtataaacttcttcaagaagacaactatgtgtccttggatata
gagcacttagagaaagctgatggcggtgaatatgtttgcaaattgacaaacaaagcagga
acttgtgaatgcaggggttcgctgatagtaaaagagccaccaggttttgctttaaaactg
gaacctcaagccgttcttcctaattctacggtgcgatttaagagtactttgaaaggaaca
cctccatttacagtgaaatggttcaaagaagagacagaactgattactggaccctcatgt
tttactggattggaggggtcttcatgctttttagacctttatactgtcggagtgtcgcaa
agtgggatttatacttgtcaagttagcaacgatgctggtacagcaaggtgtactgctgaa
ttactggtgaaagaacctccagaatttgtactgaaactgccacccactaagtttgtcaaa
caatatgaggcactgcgtcttgaatgcaaagtgattggcactcccttaattcgaatattg
tggtacaagaatgaaaatgtaattgctgaaggtggaaactacaagatgtcatttgtagac
tcagtggcagttctcgaaattcccatctcaagatttgaagatgatggcatctatacatgt
gaagctcaaaatgatgctggaagcattagctgtagcacaacactcatcgtgaaagatcca
ccatctttcatcaaagtacccacatctgtggaaggcacacgaggaagagatgcaagtctt
gactgtgagctaaaaggaactccaccttttgagatcacctggtacaaagataaaaagccc
gtcaaggagagtagaaagtacaagtttgttcttgagggttgctcagttactctgcatatt
ctcagtttggatgcctctgatgttggtgaatatcagtgcagagcattgaacaatgtagga
agtgacacctgcagtagcacagttaaacttagagagccacctgtgtttgtgaagaaattg
tccaatctgtcagtcatttctggtgaagaggcaacatttattgccactgtcaaaggctcc
caaccaatgacggtgtcttgggtgcaagacaaagaccatgttctgagagatggtgacaac
agaaaaattacctttgaagataaccaaaccaccctaagaatttttaaggctgatgaaacc
tgtgccggcaaatacacatgtcaagttaaaaatgattccggagttgtggagtctgttgct
aagttaactgtgctagaacctgcatcaattgtggatagacctgagtccttcagtgtcaca
gcaggagacacagctgcattagaagttacagtagctgggacaccagagcttaaaccaaaa
tggtttaaagatggggtagaactgtcctctggcaaaaagtacaaaattaccttctcaaaa
atggtgtctactctaaaggtcctttcagtagagagtcttgactctggagagtacacattt
gaaattaaaaatgaagttgggtgtgacctctgcaaaatctctctgactgtcttagataaa
atcatacccccaacattcatacggaagttgaaggactctcatctgatcgtgggtaagcct
ggccagatggactgtaaagtctcaggttcaccgcctttcattatttcttggtaccatgat
ggagaagagataacaagtggaccaaaccatgaagttgccttttgtgacaacacttgcacc
ttgaatatgcccattcttaaactctctgattctggggtttacacatgtaaagctgtaaac
actgctggggccagtgagacaagtgctactttgtatgtaaaagaaccaccttcttttgtt
gaacgaccacaacctttggaagcactgccaggcacagatgttaccttttcagccattgtc
aaaggaagtgctccacttaaactgaaatggttcaggggtagcaaagagattatatctggg
caaggatgtgaaattgcccttcaaggaaatattgctactcttaagctgttcaagattgat
aagtcccatgcaggagagtatacatgtcaagtaattaatgatgctgggaaggaaaattgc
cctgtcagtctatttgtaaaagaacctgcacattttgtaaagaagctgaaggacctggct
gttgaaataggaaaattgctgtttcttgaatgcacatatgctggaagcccagaaatacaa
gtgaaatggtttaaagatggtcatgagctctattcctcttacaaatataacatcacaacc
actgagagctcctgcatacttgagtgtctcaactgtgacaaagatgatagtgggaaatac
tcctgtgaagtttccaatggagctggaagtgattcatgtcacactcaagtgtccatttta
gaaccaccatactttattgaaaatttggaaccaatggatgtgactgttggagatgcagtt
tgtctgaaatgccaaataggaggaacacctgaaattaaagtttcatggtttaaggtagat
gggaaagtgcggtcttctgctgcctgcaaaattgagttcagcagagggattgcctgcctg
aaattatctaaagtttgcaaaagtgatattggtgaatatacttgtaaagctgaaaaccgc
ataggatctgcatcttcaagttgtcgcttaacagtgcaagaggctaaaacaccaccttct
ttccccaagaaaataatgagccttcagcagactgaaggacagccagttagatttgaatgc
cgtgttgcagggtcttctcctatggaagtttcttggcttaaagatggtgaatctttacaa
cacggtgatgaatactcaatgtcttttgatgataattccgctgttttaaccatatccaga
ggtgaaatgagacactcaggggaatatacgtgtgtagctaccaacagtgttggaacagca
tcttgtagagccaaactcacactacaagaaccaagatatcccccggtctttgataaaaag
ctgcagcccgtggaagttttggttggagacagtgtagatcttgaatgtcacatgactgga
tctttaccaataaaagtaacttggtcaaaggatcataaagatattcgtgcagcaggaaac
tataaaatctcctgtctggaaaactctccacatctcactattttgaaagcagataaagca
gattccggccagtactcttgccatgcgagtaacgatatcggaaaggactcttgcaccact
caggtttcagtaaaagagcgcaaaatccccccatcctttacaaaaaagccttcggaagtg
atggtggatgttgaggggaaggtggtgaagctagaagggcgtgttgctggatctcaacct
atgagcattagctggtttagagacaactgtgaaatctacagttctgacaatgtggagatc
tccttcagaagcaatgtagctgtactgagtataaagaaggctcagctctcggatagtggc
acttacacctgccaagcaagtaatgaagccggtagtgcctcttatcaggtctctctttct
atcacagagcaaaagatgcccccaatgtttgatcgcccactcaaagcagtatcagttaat
gagggtgagagtctgcatctgagctgtcaggttcggggatctccacctctgacgatccag
tggatgaaggacaggaaagagataacatcatcagctaatatgagaattacctttgtcgaa
ggcactgcgactttggaaatcagcgctacttctaaatcagatggtggtgactatctgtgc
aaggtcacaaatgatgccggaaatgaattctccaagtccagggtgaccatcaaagaaaaa
gcaggtgtcgcaccagcagctgctgaagccatgccagcacttgcaaaacctgtcaagaaa
ttggaaaacctgttcttcgttgatgaacctaagagtgttaaagtaactgaaaagggcaca
gcgacattctttgctaaagttgggggtgaccccattcccagtgtcaaatggatgaagggc
aagtggaggcagatcactcatggtggtcgcatcactgttgaacagaagggacaggattgt
aagctagagatccgagaggtgaccagaacagactctggccagtatagatgtgttgcactg
aacaaacatggagaaattgaatgcagtactgacttaaaggtagaggaaaagaaagaagcg
actcttcttgagggggatttacgagctaaactgaagaagacaccttccaaacagaagagt
ccgaaagaagcccaagaaattgacattgttgctttactgaggaacgtggatccaaaagag
tatgaaaaatatgctcgtatgtatggaattacagacttccgtggcctccttcaggctatt
gaatgcataaagaaagagaaggaacatgaaactggaagtccagaagtggaatatgcagac
cgggagtcaaatttggatttagtaaagttagtctctgacttgcaaagaagaatggaacag
actgagcctatcactctggtcaaggacataacagatcaaaccacagtaaaagataatcag
gcagtgtttgagtgtgagatcaagatcaattaccctgagatcactctcacttggtataaa
gggacccagaagcttgagtctaatgacaagtatgaaatcacagttgtaggtgaccgtcac
ctattaacaatcaaaaactgtcaatctgttgatcaaggaaactatcgcattgtttgtggc
ccacatatctccagtgctagattaacagttaatgaagctaaagaggaggaacacatgagt
cctgttactgccaaccaaatccatttcaccaagcgtatccagaacatcgaggtgaatgaa
cgtcagtcagccatctttgaatgtgaagtctcgttcgacagcgccattgttacatggtac
aaaggcacatgggaactcaaagaaagtctgaaatacagctttcgaagtgaaggtcgccgt
cactttatgatcattcacaatgttacatcggaggatgaaggtgtctattcagtgattgca
cggttggaaccaaatggtgaagcaaagagcactgccgaactttacctttccagcaaagaa
attaatgcaggaaaatatcccactgttttagatgttcctgagtcatctatacaagtgcct
ggcatgccatcatcaatcactccgagagctaaggttgaagacactgttgtaagagctgac
gttgaaacaagtgatgaaggacaaattaaagttcctgaacctgttgctccgagtttacca
gaggcctcaactgccacaaaagctgcacttccaactaaggatgaacccgaaccaaagcct
acaccatcaaagacagctgaggcatatccctctagagttcccaagaaagctgagcagact
gcaactactcaaaagtgggaagagatgtcttatgagtttgagatttctcacacagaagaa
agttatcttcaaaaagacacgtattaccatgcagagctctgttctgatcaaaaggagatg
cttggcacagaagatacacctgttttcagagataagattatttcaaagatggaagatgac
tctcaacaccttaaacacaaaacactgaaaaacggggacaaaaagaaggtggagccttct
aagaagaaagacgtgcctgggatgactgatgaaagtcctcagatcaccattttccagaag
aaaagttcatcattggacgaggcttcctttgttttccaaggctttttgaaggaccctcat
gaagatattgagcccaatgtcctggtgcctgaaaagaaagaacaatcagagaccactgct
cttccagaagaagttcctgattcagtgaatcaagttgtttgtctgaaagtgccaaaagtt
ggaaagaaagttacaccagagccaaccaaaaatgctcatgttcttcttcaagagaaagcc
tctccaccagaagataaaccaaatgaagtcacatcatcttttaaaccaaaaggtaaaatt
tctacagtggaggaaacttttgagatgtcgtcactgaagaaagctaccatgctatcaaaa
gggatggaagaagaagaacctgcaaaattaaaaacaatgtccaaatttctgaccgatgaa
atgttaagagtaccagaaacaactcttcagaaagctaggaagactccaagtcatgaaaaa
gaagaaaagatgacctctagtactgtaacacaagaagtggaaggtattaatgaagctgcc
aaagttcctaaagaggaaataccacaggaaccaagttttacttttgaactatcaaaagtt
ccaacaaagcatgtggaacaagaagcagtgaccttaataccatttgaaaaacttgctaaa
acagaggaggtgttggacaaagagattaaacatgatgaggaaatcagacccttggttttc
aaaccaagtgacagaccacaaaaagatgaatctgttaaaggtatgtcccttaaggttgac
agaaatctgaaagatgaaaaagtacaagagagcattgttttaaaacctgttgataaaaaa
ctcatagctgagaaaccccaggaactaggcaaaccattgccaaaagtaaaaagagtcaca
actcatgaacagaaaaaggaaaaagttgagctgaagccattttcaaaaacccctgaactt
gaagtatcaacacttccaacaaagcaggtagaacaaaaagcaattaccttaacaacattt
gaaaatcctgctaaaacagaagtagagttggactatgaaaataaacatgatgaagaaatc
aaatcactggttttcaaaccaagtgacaaaccacaaaaagttgaatcagataaaggtatt
ccccttaaggctgacagaaatctgaaagttgaaaaagaacaagagagcattgtcttgaaa
cctgttgttaaaaaactcataggtgagaaaccccgagaaccaggcaaaccattatcaaaa
gtaaaaagagttccagcacataaacaagaaaaggaaaaagtcgagctgaagccgttttca
aaagctcctgaacttgaagtatcaaaacttccaacaaagcaggtagaacaagaagcagtg
actttaataccattggagaaacttgccaaaacagaagaagtgttggaaaaagagattaaa
catgttgaggaaatcaaacccttggttttcaaaccaagtgacaggcctcaggaagataaa
tcaattaaagaaagtttttccctgaaggctgacaaaaatctgaaagatgaaaaagagcaa
gagagcattgtcttgaaacctgttgataaaaaactcataggtgataaaccccaggagcca
ggcaaaccattaccaaaagtaaaaagaattccaacacatgaacaggaaaaggaaaaagtc
gagctgaagccgttttcaaaagctcctaaacttgaagtatcaacacttccaacaaggcag
gtggatcaagaagcagtaaccttaataccatttgaaaaacttgctaaaacagaagaagag
ttggacaaagatattaaatgtgatgaggaaatcagacccttggttttcaaaccaagtgac
aggccacaggaagatgaatcaattaaagaaagtatttccctgaaggctgacagaaatcta
aaagatgaaaaaggacaaaaggacgatgtcctgaaacctgttgataaaaaatttataggt
gagaaatcccaggaacctgtcaaaccactttcaaaagtgaaaagatttccaacacatgaa
caggaaatggaaaaagctgagctgaaaccatttgcaatagctcctgaacttgaattaaca
acacaaaaaataacttcactgtcatacagaaaggactcaacactcaaaaaaccagaaaaa
gatgcaaagaaagaaaaagtaaaagatcttagcactttaccaaagggtgctgaaatacct
gcagtaccagaaaaagagactgaaaagactacaaaaaccataacaccacatgaaaaggaa
gagaaggtagttactcctaaggaaatgcccttaaaaagagagaaagggagtctaaaagaa
gatgaaacgtcaatgccaataaaaagaacagcccatttgccaaaggaaagtgatgaaaac
gacagaaagaaagaaataccacaaaagcatattgagatatctacaccagagctacagtta
aaaaagacttcttcctcaaagactgatatactaattccaaaagacattgaattgtgttct
gtagagagcaagcctagtattcaagacactaaagtactaccaaaaaaattatctcctaaa
gactcaattgagacagttacccttaaaaaggtaccaaggaaacaaacaccccctgacaaa
aaaactagtgaagaggctccagtgacagcggggaaaggaataataccagctatgaaagaa
atgtcacctgaatctatacagttcagacaagttccaacccagaataagggtgatgtgttg
gaagaaggatcagagatagaggcagaaagtgaagaagacactttaggttcagagctaact
cctcttgagagttatgtatcttctgaagattgggaagaaacagcctcagaggaaggggct
cttgagactccaggaatgaagggtgaaaaacgagcaaaaaagacaccttcacctggagat
ggcgaaaagaagaagaaattgaaacctggtgctggaggtgacaaaccaccaggggatgca
ccatttggattccagcttaaagctgtccctttgaaatttgtaaaggagttgaaagacatt
gtgctacaagaagctgagtctattggctcttcagcagtctttgagtgtcagatttctcct
tctaccgctatcacctcatggatgaaggatggaagcaacttgagggagagtcctaaatac
aaatttacttcagatggaaaggatcgtaaactagcaattgttgatgtgcagctatctgac
actggggagtatacttgtgttgccaagcttggcaataaagagaagacctcaactgccaag
cttgttgttgaagaactgcctgttagatttacaaagaacttggaggaggagatttctgtc
attaagggacagccattgtatttgacctgtgagctgaacaaagaaagagatgttgtctgg
aagaaaaatggcatacctattcagcgaacacctgggaagctggctatcaatgtcattgga
cttcagcatgctgtgaccatccagaacaccactgatgatgatgctggtgtttattcatgc
gagtgtgaaaatatcaagactgaagagaatgttaaagttgttgaaatcatcagagactgg
ttaatgaaaccactaagagaccagcatgtgaaacccaaggccactgccaccttcaaatgt
gaactgttcaaggacactccaaactggaagtggttcaaaggagatgaagagattcctagt
gagcccaccgataagactgaagtaagcaaggatgacagaatcatcacactaaatgtcaag
aatgcatctcctgatgatgttggggaatatgcaatggaggttgaaggccggagatatcca
gctaagctaactcttggagagcgtgaagctgagattttgaaacctctcacaagtgtggag
gtctatgaaaaagagactgctaacttcgaaactgaaatttctgaggaagacattccagga
gaatggaaactgaaaggtcaaattttgacaagatcacccacttgtgatatcaggtcagaa
ggacgtaaaagatttcttacgctaaaaaatctggaagttgaacaatctggtgaaatctct
tatcaagctctgaacgccctaacgactgcaatgctcacagtcaaagaaattgaaatggac
tttactgtgccacttaaggatgtatctgtgcctgaaaagaaacaggccctgtttgaatgt
actattacaagagatgtgcccaaggtgatgtggttaaaaggatcagacatcataacatca
ggcacaaaatatgatataattgataatggaaagaaacatatattacttatcaacgaatgt
gaatttgatgatgaggatcaatacactattgaagttctggacaaaaaatcaacagcccga
ctcactgtagaaggtatgagactcaagttgaccacacccttaaatgatcaaattgtgaag
gagggtaaaacagctcggtttgaacttgagctcagtcatgaaaatgtaccagtgacatgg
tacaaaaatgaaatgaagctgcacccaagcagaactgtggtttcctatgtagatggaaaa
aaacatgttttagaaatcaaagaagtcactttagacgacacctgccagattaaagctgag
gctaaaggaatatccacaatggctaacctgacggtgatagaggctgatccgtactttact
gttaaattacaagattatactgcagtcgagaaagatgaggttatccttgactgtgaacta
agcaaagatgttcctgtgaaatggtaccataatgagacagaagtcacagcctctaagatg
gtcagtatgaaggctgatggcaaacggaggatcctttcaatcaagagagtagacaacaaa
gacaagggaacatatgtttgtgactgtggaacagacaagacagtggcagaggttaatatt
aaagctcgtgacattaaagtggttcgtcccctgtatggtgtggagctctttgatggagag
actgcacgttttgaggtggagatctctgaagatgatgtgcacgtccagtggatactgaat
ggagaagtcctatcaccatctcctaatgttgaaattatagaagatggtgctaagcacatc
ttgacattgtacaactgcaaagtccctcagtcaggagaagtggaattccaggctgctaat
gccatgtgcagagctactctgaaagtgaaagagcttccacttacgttcatcactcccctg
ggtgatgtgcaagtatttgaaaaggatgaagcaagatttgagtgtgaagtatctagagat
attaaggacttccattggctgaaagaatctcaggaactgagagctgatgagaaatttgag
gttctcaatgaaggtaaaaaacatgttcttgtggtcaaatctgctgcctatgaggatgaa
gctaaatacacgtttgaagcagaaaataagaggtccagtggcaaactaatcatcaaagga
attcgacttgaatttatcaaacctatcaaagatgtaacagtgaaagaaagggaaactgca
gaattcagtattgaactgtctcatgaaaaagtatctgtgacttggtacaagaatgatgtt
cgacttcaccctagcaaagttatccgcatgtcagaggatgggaagattcatatacttacc
ttcaaagaagtttcccttgatgatacatccgtcattaaggctgaagcactcggaaaaagt
actgaggctatgctcactgtcctcgagggagacccttacttcatcacccaattacaggac
tgcactgcagtagaaaaggacgaagtggtgctcatttgtgaagtgaacaaagctgctgct
gaagtcaaatggttcaaggatggcaaggagatcactccctccaaaaatgtgcttgtgaaa
tcagatggaaacagacgcattttaactgtgaagaaggcagagaagggaaacagtggggaa
tatacatgtgactgtggttctgataagactgctgctaaattaaatattgaggaacgtgac
attaaaatcatccgccccctgtatagtgtggaggtgatagagacagagtctgctcgcttt
gagacagagatctctgaacaggatgtccatggtaactggaaactcaatggagaagcactt
caccagtctcctgactgtgagattaaagaagagggcaccaagcacattcttatcctgcac
aatgtgttcatgaaccaggctggtcgtatagagtttcaggctgctaatgctaaatccagt
gctcaacttagagtcaaagctcgtgtcattggtgtggtacggccactcagggatgttact
gttactgttggggagactgccacatttgagtgcgaattaaattatgaaggaatcgttgtg
gattggtttctcaagggcacaaagctggttccaagtgacagagttgtctcacgtgctgat
ggcaaagttcacaccctatcgatcagagatataaaacttgatgaggctgggcaaatcaaa
ctgaccaccgaagacttcctcactcatgccaagctcattgttaatgaaccaccagctgaa
ttcaccaagcctctggaagaccaaactgttgaggaggaggctactgtgaccttggagtgt
gaagtgtccagtgaaaaagctgaggtgaaatggttcagagatggacaagaaatccgcaaa
actaagaagtataatattgttgctgatggacggaagagaaagctcataattcaaggctgt
actcttgatgattctaaaacttacacttgtgatgccaaagattgcaagacatctgccttc
ctgaacgttgagccgctgcgtgttgaattcaccaagccactccatgatgttgaagtcaaa
gagaaggattcggccagatttgaatgtgaagtttctcgtgagaatgcaaaggttcaatgg
ttcaaagacggcagtgaaattagaaaaggcaaaaaatatgacattattgccaagggggtt
cagcgcattcttattatcaacaaatcagtctttgaagacgaagctgaatatgaatgtgat
gccagaactgcaaaaacctctggaatgcttactgttattgaggaagaggctgtgtttaca
aagaatctgtccaatactgagggtaccgaaactgacagtattaagatgatctgtgaggtg
tcaaagcccagtgcagaagtgagatggttcaaaggtgaccaagagctgcctgaggggggt
agatttgaacagattcaagatggcagaaagaggatacttattatccgggaccttcgtatg
gatgacgttggagagtacaattgccgattaccaagttcacaaacctcagcgacactgagg
attaatgaactgccagcggaattcattactaggcctcagagccaagaagtggttgaagga
gaaaaggcggagtttgtttgttcagtttctaaggacacttatgaagtcaaatggttcaag
gatgacaaggagcttgaagttggagacaaatatgatatagtttttgatggcaagagaaga
gcacttattgttaaggattgtttgctaaaagatgagggtccctatgttgccgacattggc
tcttcaagagctactgcagatctgattgtgattgaaaagcttaggatactcacaccttta
aaagacataaacataacagaagggcaggatattgtcttcaactgtgaggtgaatactgag
ggtgctaaagcaaagtggctgaaaaacaatgagacaatgtttgagactggcaagtttgtt
atgacccagaaagataatgtgttttctctgagaatcaaagacactcagaagtcagatgaa
gctaattacaccatcaccctgacaaatcaacgtggtgaatatgtccagagctctgccaac
ctcattgtacaagaggatgaacttaggataactgagccccttgaagactgtgagagtcaa
gaaaagaggacaatcaccttttcttgcaaagttaacaaaccaaatgttgcagtaaaatgg
atgaaaggaggtcaagagatcaccttcgacaaacgtattttgtacaaagtggacaaaacc
aaacacactttgactattaaggactgcagcctggcagatgaggcagagtactcggttatt
attggttctgaaaaatccacagctgaactaatcataagtgaagccccaactgacttcatc
acatatctcagagaccagactgtcactgagtttgaagatgctgaattcagctgcaaactt
tccaaagagaaagcagaagtcagatggtacaaggatggtcgagaaattaaagaaggtcct
aggtatcacttggaaaaagagggcaagatatgcagactgtatatcaaagaatgcagacca
gatgatgagtgtgaatatgcctgtggtgttgacgataggcgctcaagagcaagactcttc
gttgaagagatgccagttgagataatcagacctcctgctaatgtgtttgaaccccctggt
tcagatgttgtgtttgaggttgaactcaacaaagacagagttgatgtaaaatggctgaga
aataatatggtaattgtccagggagacaaatatcagatgatgagtgagggtaaggttcac
aggcttcaggtctgtgagataaggcctcgggatcagggagagtacagagtcattgccaaa
gacaaggatgctagggccaagctggaattagcagctgcaccaaagatcaagactacagat
caaaatctcgtgactgatgctggaaagcctttagtcatgactgttccctatgatgcttac
ccccgtgctgaggctgaatggttttatgatgacattctcttacctggacagaacatagat
acatccaatgaccggacagaatacagattgaaagacccaaaaaaatctgatcagggtcga
tacaagattgtccttcagaacaaatacggaatgggacaggcaattattaatctggatgtt
attgacgttcctggacctgtaaagaacctaaaagttgttgacactgctgatggtgaggtc
acccttgcctgggatgagcctgaaagtgatggtggaagtaaattaattgcctatgtggtg
gaaaggcgagatatcaagcgaaaaacctggactacaattacaaaccatgctgacagtcct
gagtactgtgtgactgacctaaagagggactctatgtacctttttcgtgtctgtgcccgt
aatagagtcggaagtggacctagcgtggagacagacgaagctgtccaagcaaagaatatg
tttgacgttcctgaggcaccacggaatgtcatggttggaaacataaataaatttggtgcc
actatatcctgggagcctcccgagtatgatggaggatcagaaattacagcttacattatt
gaacttcgtgacaggacctctgttagatgggaaccagctcttgttactaaaccagaggat
cgaaaagctgtagtcaatgatgttgtggagaacaaggagtatatcttccgcgtaagagct
gaaaataaggctggaattggcaagccaagtgttgctactgatccagtgaagatcatggat
cccactgaaagaccaagtccaccactgaactttgactactctgatcagacaaagacctct
gtcctgctgacatgggacacacccttgagcaatggaggtagtccaatcactggctacatt
attgaaaagtgtgaggatggaaccgacaagtggctcagatgtaacgccaggctttgccag
gacttatgctaccaggtaactggcctaaaacatgagcagaaatacaattacagagtatca
gctgaaaatgcagctggtgtttcagacccagctgaacagattggacctctcacagcagat
gatccacatgttgcccctactatggacctcagtgcattcagggatgggctggaggtgatc
gttcctcaccctcttactatccacataccaatcaccggataccccctgcctactgcacac
tggagtgttgcagacaaggcattggctgctggagatacagtctccatggttactaaaaac
accttcaccaagttagtcattactcccagtgtccgcccagacaagggtatctacactata
caccttgagaatgatgtatccaccatatcaggagaaattgatgtcaacgtcattgcaccc
ccaagtgtacccagagatttcaaggtagcagaggtgactaggcatcatgtgcatttaatg
tgggaagcaccacaggatgatggtggaagccctgtgattggataccaaattgaaaagcgt
gaggcatctcgcaagacatgggttaaggtcattactggtgtagagcagcttgaatataca
gtcacagatgtcattgaaggaagggaatatctgtttagagttactgcctgcaacaagtgt
ggtcctggagagccagcatacatcgaggaaccagtgaatgtgtcatccccagccactgtg
ccagacccaccagagaatttgaagtggagagacaaatctgcaaatggaatcttcctctca
tgggaccccccaaagtgtgacggtggctctgtaatcaagggttacattgttgacaagtgc
cagcgtggcactgacaaatgggagccctgtggtgatcctgtgcatgagccaaaattccag
gtgactggcctcactgagggacagtggtactcatatcgtgtcagagcattgaacagactt
ggtgctagcaaaccttccaaggttacagatgaaatccttgctgtggatcctattgaacct
cctgagattatgctcgatgtgaagttgcttgctggattgactgccaaggctggaaccaag
attgagcttcctgcagatgttcttggaaaaccagaaccaaaagtcacctggaccaaagct
gaccttgttttaaaagcagatgacagagtgtcaattgagaccaagcctggtcattctaca
gtgtctatagccaaaacgaaaagagaagacacggccacgtacatcattgaggctgtgaat
gttgctggccgtgctacagcaactgttgatgttaacattctcgacaaacctggtcctcct
gctgcttttgacattactgaaatcaccaacgagtcctgcctgttagcttggaatcctcct
agagatgacggtggctcaagaattactaactacattgtagaaaggaagacttcaggcagt
gaggattggtgcaagctgtcctccacagtgaaacagactagcttcaaggcctgcagtctg
gtggcactgaaggaatatgtattcagagtgtttgcagagaatcagtatggaattggcccc
ccaatagagcatgttcccattattgccaaatactcctttgattcaccaagtgctccaagt
agacctatgccatctgatattgcaaaggactctttgaccctgacatggtatgaacctgat
gatgatggtgggagtcctatcactggatactgggttgaacgttttgatccagaaaacgac
aaatggataaaatgcaacaagataccaatccaggacacaactttcagagttaaaggactt
gccacaaaaaagaagtacaagtttcgagtcttggcggagaatcgtgcaggacttggaaaa
ccaagtgaagatactgggcaggttttggtgaaggacccaattgatcctccatggcctcct
ggtaaacctgttatcaaagatgttgcaaagacatctgttttgcttaagtggaccaaacct
gagcatgatggcggggccaagatacattcttatgtaattgaactgcttaaaactggaact
gaggaatgggtttgtgtggccgaagatgtccccatgactgaacactttttgaagggtctg
atggagaggcaagagtactcttttagaataagggctgtgaacattgctggagagagtgaa
ccaagtgaccccagtgaccctatcatctgcaaggaaagcctttatcctccttcaccacca
cgctggcttgaagtcgtaaacatcaccaaaataaacgcagagctaaagtggacatttcca
gagaaggatggtggctcccctattacaaactacattgtggagaagagagacgttagacga
aaggcctggcagacagcggacaccacagtaaaagaaaccaagtatactgtaactccacta
aatgaaggctctttatatgtgttccgtgtggcagctgagaatgctgttggtcagagtgat
ttctgtgaactggaggactctgttctggccaaggatacttttactaccccaggaccacct
tatgcattaactgtagtagctgtaaaaaagagacatgttgacctgaagtgggaagctcct
aagaatgatggtggtagacctatcacaaaatatgtcattgagaagaaggataagcttgga
actcgttgggttaaagttggaaagactcaaggacctgaatgcacttaccaagtcacagat
gttattgaaggaagtgaggtgcagtttcaagtacgtgctgagaatgaagctggtgttgga
cccccaagtgaacctacagacgtacttacaattgaggatccaacaagcccaccatcccct
cctcgggagctgcatgtcactgataccagcagagatcacatttctgtcacctggaatcca
ccagagaaaaatggtgggagtccaatccttggctatcacattgagctttgtgaagctgga
actgagaaatggatgcgagtcaacccacgtctcattaaagaactaaaattcaaggcagaa
gaaggaatcattccagaaaaacagtacacgttaagagtccgagcagtgaatgctattggg
gtcagtgacccatctgaggtttcagaaaacatttctgccaaagatccagactgtgcccct
accttagatctgctgacccaagatattgtagttatagagggccagaagttacagctacca
gtccattacagagcaataccctcaccatctgtatcttggcaaaaagatggaacaaacctc
attcctgatgacagactccatttgagttgtgatcgtgctattgctcatattaagatttct
aaatgcaatcatgaggatgctggcatatacactgtcactctagagaacaaacttggagca
atcacaggaacagtaaatgtgatagttattggtgtccctggtaaatgtaaagatattgct
gctagtgaagttacaaagaactcctgcaaaatctcatggaaacctccagattttgatggg
ggaagccctattcttcactatgttttggagcgcaaggaggcttccaagaagacctataga
cctgtgatgtcaggagaaaatgtactgagttggaatgtcaaagacttgcttgttaatgcc
gtgtactacttccgagtcagggcagtcaacaaggttggcgggggagagtacactgaaatc
cacaaccctgtgattactgaggatcaaaaagaccgcccagatccacctgttggtgttaaa
gtagacaatattacttctcagtccgtacacctgacatggaatccaccagcatttgatggt
ggttgccccattacaggctatattctggagaaaatagaaaaagatggtactaaatttgag
agatgtaatgaatccctggtacctggattttcttacactttgaagggtctgatggagggt
aaagaatatcagtttcgtgttcgtgctgaaaatgctgtaggagttagtgatccttctaac
agcacagcactagtaaaagctatagaccctgcagatcctccaaaggtttcccttagagga
agcttgaatatcaggaaaggtgaagaaatacaattagatgccatcatatctggatctccg
tacccagctgtgacatggcttagaaatgatgaggccattcagcctgaaaacatcagaaag
cgacagcagaaatcagctgtgaggaggaaagctaaaggtattcattcccagcttgaggaa
ccataccaactatcccttcctgaaagactttcttttgacttcagcaagaaaggtgaagcc
accttgatggtgcgtgattccattagaagcgaccacggaattttcacagtcaaggctaag
aatgctcatggcactgcaactgcaatatgtgacgtgaatgtgctcgatgtacctggacct
ccaattaactttgtatttgaggaaatcagaaacacgtcagtcatctgcatgtgggaccca
cctatggacaatggtggcagtgaaatccttaactatatcttggagaaaaaagacaaaact
aaggatgaaagtagttggatcactataaactcaactctcagaagctgcagattccatgtg
actaaattgattgagacaaaggagtacatttttcgtgttacagctgagaacaaccttggt
cctggacctgcatgttactcagcaccgcttgtagcaaagaatccgtttgatccaccagat
gctcccaacatgccaagaattggagatgtcacagccaaaactatgcttatcagctggaat
gagccaaaagacaatggcagcccaatcttgggttattggattgagaagcgtgaaattaac
agcaaatactggactagaataaatcgcaacctgctcaactcactggaaatgagggtcagt
gggctggtggaaggtttaacttatgtgttccgagtatgtgctgaaaacttagctggtcca
ggaaatttcagtgttccatctgaacccaagattgcacaagatccaattctgccacctggt
ccacctgtaccaaggattgtggatactactcagtcttcaattgaaatcacttgggatgct
cctctttacactggaggtggagacatcctggggtatcacgttgagaaaattctagctggc
gaaaaagtctggtctcgttgtactgaaagattatgcaaggatcacaacttcacactgtgc
ggagttaccgagggagctgattatattgtccgtgtaatcgctgttaatgatgcaggtgaa
ggagcacctggcatgacccagctggtgacagtgaaggaacctcaagatcctcctcttgtt
gagtttgacatatctgtaaagaagggtgtcacagttagagctggagaaaaactgaagcta
cctgcccatataactggtagacctcaaccacaagtaaactggatgaaggatggtggtcat
gttgaccaagaacatgcagttattgaaactgtgggaaagaatagtactctcagtataaag
catgctttgaggacagaccatggaaagtaccaggttactggctcaaatagtagtggaact
aagactgcatttaccaaagttgatgtcatggatgttcctgggcctgtggttgatttgaaa
acaactgcagtgacaaaaaagatgatgacactgagctggtgcgatcctatcgataatggt
ggaagtgatattactggctatattgttgaaaggaaggatgcaaatatgcacatttggaga
cagccaatggaaacaacttcttgtaaatgcgaaattaggggatttcttgaaggaaggcag
tacatgttccgagttgtggcaaagaacaagtatggatgtggtcagccagtagatttgggt
cctatccttgctgtggatcccaaaggtcccccaagtgcacctcaacaattccactacact
gaacggtctaagtcatcaataaggctgtcctggaaaccaccgcagagtgatggtggtagt
cctatttggggatattatgtagagaagaggagacaaggtgaaactgaatttgaggttgcc
aatcggcagatatgcaagacactatctttaatggttgaaaatctctcagagcatcatatg
tatgacttccgtgttaaggcagtaaatgaagtcggagagggagagccaacagaaatttta
agttctatcattcaagatgatgaagttaagccatctgtgatgttgcttaagcacttcaag
ggtgatgtaatcagggcaaagaaaggggaagctgttgaaatccctgcagaagttacaggg
ctcccaatgccaaagattgaatggtctaaggatggaactggtattgacaaacccactgaa
atacttttaattgatacaaaagaggttagcaacaaaacagccaagaccacacttagtatc
cctgaaactcaaaggcatgataaaggcctttataaattgactgcttcaaactttcttgga
tctgcagatgtgaacataagggtggaaatatttgaccgtccatcagctcccagaaatatt
gtggttgctgatattaaagctgggtcttgttatctcacctgggatgacccagaagacaat
gggggaagtgaaataacaaactatattattgaaaagagggatggcagcaagaagaagtct
gattgggaggagattacaagttgtgtccttgagaagagatatagggtctccaaacatgag
accaatggcatttaccagttcaggatcaaagctgaaaataagtatggaatcagtgacgga
tgtgagtcggagaaagtaattctcaaggatccatacggcctgcctgggccgccgcaaagg
ccaaaggtcattggacattcccagtcatccatgctggtaacttgggaaccacctctagac
aatggtggttctccaattacaggctactggattgagaagagagaaaaaggagctgtgtac
tggaatagagtgaacagggctcctattacaaaaccagcagtaaaaggcctagaattcaat
gttctccacctcaataaagggtgtgaataccaatttcgtgttatggcttgtaatgctgct
ggtgtcggacccccaagtgaaccaactgagagtgcgtttgctgctgatcctcaaaatcct
cctggtatgccgtcaagccctgaaatcacagacaaaaccaggaacagtattactctttca
tggaagccaccagaaaaagatggtggtagcccaataaaaggctacattgttgagattcaa
gacgaggactccatagaatggaaaccagtgaatgagctagagaaacctcatcctacctct
caatttacggtgtcaaatcttgaagaaatgaagaaatacaagttcagaataattgcagtc
aatgatgctggcaagtctgaaccaagccctgcaacttcagaaatccttgttaaggagatt
aaagaggagccaaaagttacactgaatgtcagtgctcatgagttcttgtcatgcaaagct
ggttcatcaataaaaatccctgcaactatcactggacatcctactccaaaagtttcttgg
gagtatgatggaaaggcaaagaccgaaaagaaagatggccttcatattcttccacttgat
tcacagattatatctactgatacgacatcaaccatcattattcctgaatgcaaattatac
cacactggcaaatatataatctcagctgaaaatgaagctggacagaagcttcttaaagta
ctggtcaatgtttttgatttgccaggacctccaagagaactaaaagtgtctgatatcaca
agaggctcatgcagacttacatggaagcctcctgatactgatggtggtgaaagagtaaag
agttactttgttgaaaagaaaactgttgaaggaaaggcctggacaaaagtgaattcagct
tgtgttagtcaaacatttgttgttcctgacctaattgaggggcaggaatacttgtttcgt
gttcgagcagaaaatagcttgggtttgggaccatgcactgagactgttcaaaggacaaaa
gccagagatcccgtttatcctcccgatcctcccagaagggtcaagattaatgctgtgatg
aagaacactgtgacccttacatggaaaccacctaagaatgatggtggagctcctgtgaca
cattacattgtggaatgtctttgttgggaacctagtgggtcacaaaaggaatactggagg
cagtgtaacaagcgtgacattgaaaacaccacttttatgatcgaggatctcactgaagat
aaagaatacgaattccgtgtgaaagccgtcaacaacgctggggcgagcagaccatcttcc
actgttggaccggtgacagccaaagaacagacatgtgcacctgctgttgaactcaacgaa
tttatggaagttgagcaagggactgacatcaatattcttgctaaaataaagggatgtccc
ttccctaccattacctggcaaaaggcccaaccccacaaaagcaatgaaaagaccgaggtg
caatatgatgagcatattaacaaacttgtgacagacaatagctgtacactgcttattcgg
caggggaaaagaacagatactggtctatacacaattacagctagcaacggcctgggaacg
gcttcaaaagaaatgaggcttaatgtcttgggatgcccagggccaccttctgcacccata
aaatttgaagaaatttctgctgggaagattacactgtcttggcttcctcctaaggatgat
ggtggttcaaagattacaaactatgtactacaaaagcgtgtggctaacagaaagatgtgg
gtacccgtcaccagtaatgccaaagagaggatatacacagtggaaaatctgatggaaggt
catcactatgttttccgtatcatggctcaaaacaaatatggtattggtgatccacttgac
agtgaaccagaacaagccagggatcatttcaatgtccctggccagtgtgaaaaaccaact
atatctagtgtgactcatgactctatgacagtcaactgggaagagccagaacatgatggt
ggaactccagtcactggctattggctagagcgaaaagagaccacatcaaaacgctggaac
agagtaacacgagatcctatcaaagtcttaccctttggaatttcacataatgtaactggt
ctcattgaaggatctcaataccagttccgtgtaactgctgtcaatgcagcaggatgcggc
ccgccaagtttgccttccgatccagtctttgccagagaccctacagctcctccaggacct
cctattcctaaagtaactgactggacaaagtcaacagttgatgtagagtggcttcctcca
ctaaaggatggtggatcaaaaattactggatactttgttgagtacaaagaagaaggtcat
gaagaatggaaaagagctaaagataaggaagtgagaggaaccaaacttgtagttgctggg
ctaaaagaacttggactttatcagttcagagttagagctgtaaatgttgcaggtattggt
gaacctggatatgtctctgatgtcatcaaagtaatggacagaacaattctccctgaggtt
aacctggatgcttctgtgaaggagaggttggttgttcatgctggtggtgtgattcgtatc
ctggcctatgtgtcaggaaagcctgtaccaaagatcacgtggaacagagacaatgatgtc
ttaccagaagaagctattatcgagaccactgccattagctctgccttagtaatcaagaaa
tgcacacgaaaacatcaaggaatttacactttgactgctaagaatgaaggaggagaaaaa
aagaaaaccattgtcgttgatgtactagatgttcctggcccagttggaacaccaatcaca
acagagaatcttactagtgactcatgcaagataaactggttcaacccagacgatgatggt
ggctcagctgtaactaatttcatcattgaaaaacgggaagttgatcacaaagcttggact
cctgtgtcttgcagcgtcaccaggcacagtgctgttgctcgtggtctcatcaatggaaaa
gcttatttcttcagaatagctgctgaaaatgtgattggaataggtccatttgttgaaaca
actaaagaaattgtaattaaagatcatattactgtcccagaacgccctgaagatcttgaa
gtcacagcagtctcaaaagagtatattagtttaaaatggaaaccacctaagtttaatgga
ggatctgaaattattaggtatatcttagaggcccgtcccattggcaaagacaagttcatc
cgactcacaaaggagaagctgatggaaaggaaatacacctatgctggtgtcaaggagggt
gatatttatgaatttcgtgtcagtgcagtaaatgaaattggtcaaggcaaaccctcattt
agcacaaaaccaatcacttgtaaagatgagcttgaaccgccaacaattgagcttgagttt
cgtgacaaggtcattgtacgcgtgggagagtcctttgctctccagggtcgctacactgga
aaaccagcaccatccattatatggaccaaggatgataaggagctgaaagcagatgaccaa
atcaagatcaaaagcactccaaccacaatgttcttgggcattatcaaggctaagcgtgaa
cacagtggcagatactgtgtgattgtggagaactgtaccggttcacggaaaggaatctgt
aatgtaactgttgttgatcgtccactcccaccacagggcccagttgtatttgaagaggtc
cacagagatcatatagtgatttcctggaagactcctcttgatgatggcggatctgaaatt
tcaaattacattattgagaaacaagacacaagcagggatctttggatgactgtgacatct
gcttccactaagacaacatgtaaagttcccaaactgattgagggaaaagaatatatcatg
agaatctgtgctgagaacatgtatgggatcagtgacccactggaatcggaaccagtgaca
gcaaaagacctattcagagttcctgaggcacctgagcaacctgttattaaagaggtacat
aaagacacagctcttgttatctggaaccgtcctcgggatggtggcaaaccaattactaac
tatcttttggagaaaaaggagaccacgagtaagagatggtcacgtgtcacaaggaaaatc
atctacccggacactcaattcagagttgaagaactacttgaaggatgtgaatatgagttt
cgggtcatggcagagaatgagataggagttggtgatccaagtccaccatcaaagcctatt
cttgctaaagagccaattgtgcctccaagcccacctgttctcccagaagttgtggacaaa
actaaggaatctgtaaatctaatctggcaaccacctcgccgtgatggcaaaggcaggatc
cttggctatcttgttgagtaccagaagattggtgaggaagagtgggctaaggctaatgaa
actcctgaatcatgccaagaaaccaatttcaaagtaataaacctttcagatggtgaaatg
tacaagttcagaataatggcagtaaatacagctggcaaatctgaacctgcctatgtcaaa
gaccctgtgaaagtccaagacagacttgagcctccagagcttctacttcatgctaacatg
gctcgtgagcatcttgccatggaaggaaccactatcatcctgagtgcaggcattaggggc
ataccgttccccaaagttacatgggcaaagaataatgctgaggttcctcccagggctaat
atagaagtttctggtgatgaaagtaaactaataattcagaattgtctccgttcagactgt
ggagattatgcaattactgtggaaaatccagctgggtcaaaaacagctacatgtacagta
ttagttttaggtaaacctagtccacctcggaacctgatgattactgaagtcacaagtgaa
tcagcctatctaacctggaaagaaccagaggatgatggaggtgctgttatttccaattat
gtgatagagaagaaagatgtagcatctgaaaaatgggtgcctgtctgtgcatcatccaag
aagcctagtttgttggctatgtacttgatggaaggcactcaatatatgtttcgggttgct
gcagaaaaccagtttggcaaaagtgaatatatttcaactactaaaccaataaaggctgtt
gatcctatctatccacctggtccaccaaaaaatttgcatcatgtggatatagataaaact
gaagtctggcttcagtgggattggccagatcgcacaggtggtagtgatattactggtttt
ctagtggaataccaagaagagggtgccaaagattggattccatttaaaactgtcagaaaa
accgaaagccatgtaactggacttcaagagggaaaaatgtacagattccgtgtgaaagca
gagaatgctgttggcctgagtcgtcctgatatcactgtgccaattgtttgtgaagaaaag
cttgtaccaccagctattgaggttgatgtgaagctaattgaaggtattattgtcaaagct
ggaagcacaatcaagcttcctgcaattatgagaggcattccagtccccagtccaagatgg
ctcactggtggcaatgaaataaaaagtgaagacaatattaacattgaaactttcaattat
tcaactgttctaaacattaataactgcaaaagaagtgacacaggagaatatcttctcaca
gtgtccaaccccgctggaagcaaaacagttgcattacatgttacagttcttgatgttcca
gcttcacctacaggccctgtcaacatccttgaagttacttctgagcacatgatcatcaac
tggcgtcctcccaaggatgatggtggaacccctttaataaattatattgtcgaaaagaag
gatactaagaaaccttgggagccctgggctatagtgagctctagaggaactggtacaaaa
gctaaaatttctcatttagagaagggccgtgaatatattgtacgcatccgtgcagagaac
aaagttggtattggtccagcccttgaaagtccacctaccattgcaaaacttatatttgat
ccacctagtgctccaggccaaccagttcctcatgacataacagaaaatgctgtgactgta
aagtgggaagttccactttgtgatggtggcagtccaataactggttacatagttgaacgc
agagaaatgacaggcaaatggattcgtgtgaacaaaatacctgtcttggatatcagatac
agagcttcaggactttttgaaggtaatacttatgaatttaggatttttgctgaaaacact
gctggcattagtgaaccatctccagtctcagatccagttaagcttacccgtcctgtcaca
tgtccaggacccccaaacaatttcagacttaaggactggagtaaatcatttgtggattta
gtctggacaaagcctacaagagatggaggtagtcctgtcttaggatatattgttgaatgc
cagaagttaggcagtgtacattgggacaggattaataaggatgaccttatcaagcagtgc
atatacagagtgccaggattaactgaaggactggaatacaggttccgtgttagagctgct
aacaagattggagaaggagagccaaaagaactttctgaaactgttcttgccaaagacatt
cttgttcctccagaaataactgttgatgttgcttgtcgtgatcttgtgacagtcagagca
gggcagaatatcaacctaattgctcgagttaaaggacggcctgaaccagaaattatctgg
actaaggatgcaaaggtattagagagagataagcgtactgagatgaaaaacatctttccc
attgctgatatgatcattcaaaaagcagctagagcagatcatggaaaatataccattcaa
gcaagaaacattagtggccaagcacaagccactattatagtcaatgttcttgacagacca
ggtcagtgtcaaaatctaaaaacaagttacgttactaaagactcttgcatggtgtcatgg
gagaatccagaagacaatggaggcacagaaattacaaattatattattgagtgtcgtcaa
ccaaaccaaaggggatggacaacaatttcctctgactgcactaaacgcctttttaaagca
caacttgttgaaaactgtgaatatttgttccgtgttagtgcagaaaacaaatgtggagtt
ggatcagcagctgagaccagaatggcagttctggctgttgatccagttgaaaagcctggt
gagccagagaacttccatattactgatattggcaagactttcgttttccttaaatggaaa
aaaccagattatgatgggggtagtcgcaaccttgcctatcatgtggaaaggaaactaaaa
gaagctgaagaatgggaacgactacacaaaggtgcaataaaggaaacattctttatggtt
gacagatgcattgagaaccagatatatcaattcagagtacagactaaaaatgaagctgga
gaaagtaactgggtaacaacagctgaaacagttgtcaaagaagaagtactccaaccagtc
cttaatgtaaatgtagacggtatccttgtggtaaaagctggcgacagtattaaaattgaa
gctggtctgaaaggaaaaccccatcctgaggttaaatggtttaaggatggtgatacaggt
gacatcaacaaaagccctagagttcatattgaaaacggctcaaatttttcaaaatttgta
atgacatcatcaaaacgtggggacagtggaacatatgtaatcactgctacaaactctgca
ggaagctgttctgctaatgttatcgttaatgtacttgacaaacctggtcctgtcagggac
cttgcagtatctggtatttcaatggacagatgtaaattgacatgggttcatccagaggat
gatggaggctgtgaaattcagaactacatcctagaaaaatgtgaaacaaagagaatggtt
tggtccatccactctgcagctgttataaccaattttgctaatgtgatacaccttttagag
ggaaatgaatacatctttagggtacgagcagagaacaagctgggaacaggtccaccagtg
gagagtaagcccatcattgccagaacagagttcaacagacctggtccaccaggtcaacca
gaggtcaccaaaatcggaaaggaggaaatgacagtgtcatggtgtcctccacagtatgat
ggtgggaaaccgatcaaaggttacattctggaaaggaaggaacaacatgctgttcgctgg
gttccagtcactaagagcccagtccaacaggcacacatgaatgttaccaacttgatcccc
aaccatgaatatcagtttcgtgttaaggctgaaaatgaagttggaatgggagacccaagt
aaaccttcaatatcagttactgcaaaggatccaattggtcctcccggtcctcctggtgat
ttgaaggtgaccgacagcaccaggacctccatcacagttggttggttgaggcctgcttat
gatggtggtgcgccaatcatcggatatgtggttgaatttcgaataaaggatgcaagtaaa
aagcctgatgaaggctggaaaagatgtaatgtcgctgctcagctaactataacggaattc
actgtcacaagtctggatgaaaagctggaatatgaattccgagtgtctgctcaaaaccag
gttggcatgagtcaaccagcagatctcaaaggtgctgtatcacctagagagataactgag
gcaccggaaattgatttggatgctaccttgagaaagggtattgcagttagagctggctgt
cccattagactttgggccactgtaaaaggaagaccagcaccaaaaatgacatggagaaga
atgggaatcgataatgttgtaagaaagggtcatgtggatttcattgatactatggcattt
cttgttatccctgaaaccacacgtgatgattctggcaaatactccctgactctaagcaac
tctgctggagagaaagctgtgtttgttgatgttcaagtactggacaccccggggcctgtt
gttggcttggatgccactgatattaagatgacatcctgcaacctttcttggtctccacct
gagaatgatggtggcagagaaatttcacactatatagttgaaaagcgtgaagtaaatcga
aagacatgggcaacagtcaacaatggcgtgaaggaaacaaccctcaaaattaacaatctt
acaccaggcactgaatactgcttcagggtgacagcagttaatgagtatggagctggtgtc
ccaaggatttcaccaagttcatatctgacatctgatcccattagtaaacctgatccacct
gtgaaaatggatgtgatggaaattacaaaaaatagtgtaactctaggatgggtgaaacct
ctgtgggatggaggagctaagattgatgggtatgtagttgattacttgttagtgactcca
cctaaggaacctgaagaagaccaagcagtgctccttgagcagaataaactcaaggagcaa
tggacaccatattctgtcgtcaaagatttaagcattactattgctggactgaaggaaggc
atgaaatacaaattcagagtggcagcaagaaatgtgatgggttccagtctgcccacagaa
acaagtggagtgtttgaaataaaggagcagatgttggcaccaagaattgtaatggcagat
gttgctactgcaaaagcaggagaaaagctgagggtggaagctcttgttactggaaaacct
gctccagtctgtaaatggaagcgagaagatgaagatgttgtcccatctagtcgacttgct
gtacacaaatcaccaaacagttgtgtgctcataatcaaagatgtttcaagaatggacagt
ggtctgtacagtctttctgctgagaacatcactggacaagctgaagagatactgaaagtc
ataatcaaagatacccctggtccaccacaaccaccttttgaaattagtgaggtggatgct
gatgcctgctcattgtcttggcttgcaccactagaggatggtggaagcagtatcactaat
tatgttgtagaaaaatgtgatgtgagcagaggtgactggatcactgctgtgtcttcatgt
acaaagaccagttgcagattggggaagcttgtccctggaaaggagtatatcttccgtgtt
cgagcagagaactgctttggcatttcagagcctattgtctctgagaaaatgatagccaaa
ttcccttttgatgtaccaagtgaacccttgaattgtcatattaacaaagtcagcaaagat
tgcatgtttgttgcctgggagaaaccagcaatagatggtggcagtactattactggttac
tacattgaacgtaaagagaagaacagccttctctggataaaggccaatgacacagttgtc
cgtactactgaattcccatgcgcaggacttattgaaggcctggagtatgccttcagggta
tcagctcttaatcgtgctggacagggtaaaccaagcaaaatgactgaatttacagcagca
agaacaccagttgatcaacctggcaaacctgaagtcattgatgtgactaagaattcagtt
accctggtctgggacagaccaaagcatgatggtgggagtaagatcattggatattatatt
gaaatgctaaagcttcctgaagatcagtggatacgctataacacaagcagccaaaatgta
cccgtagaggaattcactgtaacaagactacaagaaggtgttcaataccagtttagaata
cttgctaaaactgcagttaacctcagcaaaccatcggatgtctctgacccagtgctgatc
tttgctgaaaatgtaccaccaagggtagaaataggacttcagatgaagaggcttctacca
gttaaagctggagcaaatgcatgtcttgaggctgaagtgtttggaaagccagtaccaaaa
gtaacatggaaaaggaatggggaattattgaaaccttctgaacgcttgaaaatgtcacag
aggagacatcttttctttcttgagctgctatctgtgacaaaaaacgacagtggagagtat
actattcttgcagaaaatgcaagtggttcaaaatcaggcaacattaaactcacagttatg
gatgtacctggtcccccagtttctgtcaagtttggggacatatttgcagagagaataaac
ctgatttgggagccacctattttggatgggggctctgcaatcacaaactacattgttgat
aagcgtgaaacaagcagagctaactgggcccaggtcacatccaagatcagtggccagctc
actaattactctgtagaaaaactgatccagggtcacgagtaccagttccgcatccgtgca
gagaataagtatggtgtgggtgagcctatcctgacggagccagctgttgctaggaattca
tttgatgtgcctgggtcttgtgagcctcctattattactaatatcacaaaggatcatatg
acagtgagttggaaagaacctgctaatgatggtggatctaccattcttggttacatggta
gaaaagcgggaaacgaaagaagtaaactgggctaaactcaacagaaaacctgtgattgag
agaactattgaagctagtgatctcacagatggaggtgaatatgaatttagagttactgct
ctcaataaagctggccttggcaaaccaagtgatccatccagtgctgtcattgcacatgat
cctttatatccccctggaccaccagtttctccaaagattgttgacataacacgtagcaca
gttaatttgacctgggaaaaaccagttaatgatggtggatgtgaaatcttgggctacctg
gttgagagtaagagagcagattctgcagaatggatacggtgcaatgtaccaaagaatctt
cgagagactaaataccttgtaacaggcctgcaggataatatggaataccagtttcgtgtc
actgctactaacaaggttgggtttagtcaaccaagtgaagttccaggaaaatacactgtg
aaggacattttagttcctcctgaagcagaacttaacggagaactgatgaaaacactggaa
ctgcgagctggaaccccaatgaaattgtatgttccaataaagggccgccctattcccaaa
gtcacctgggctaagatgaacaccaacattaaagaaagacaaggaattgtgattaagaca
actgaatgggatactcttctgtatattgagaaagtgaacagatacgatgcaggaaaatat
atactgaacctggaaaacagcactggaataaagacgtatacaattgttgtaaaagtttta
gatacccctgggccaccacttaatctaacagtgaatgagacttcaaaagacagtgcctct
attctttgggatgctcctttgattgatggaggaagtccagtgaagcagtacattgttgag
aaacgtgatgctgagcgaaaatcatggtccacagttaccctggactgcacaaaaacatct
tttacagttgagggcttagaagcaggcaggtgctattttttcagagttttagctgaaaat
gaatatggtataggagagccatgtgaaactgcagatgctgcacgagcttcagaacaacca
ggaccagttgtggatttcaagccattattagtcacaaaggatttatgtactcttgcatgg
aagaaaccgatcagtgatggtggaagccgcattacagcttatgtcctagaagtgaaaaac
ggggaagataaatggaagactgtcatgagatcaaagaacatgcagtacagtgccaaagat
ctaatagaaggaagggagtattcctacagagtgagagcagtcaatgatgcaggtgatgga
acagttaaggaacttaatatagtagctaaagaccttactgttccacctggatgtgattta
agagatttaccaaatttatgctatattgcaaaggagggaagtactgttcgtctcaagatc
ccaatctttggcaaacctgctcctacggttatatggaagaaaggtgaagatgttacttta
acagacagcggaagagtttctgttgagtcaatggctgtcaacacaacactgttgattcat
gactgccaacgaggtgatgcctcaaaatatacaataactcttagaaatattgcaggaacc
agagaatcaatcatcttcatcagggtagttggaaaaccaggaatacccacaggaccaata
aagtttgatgaaatcactgcagatggaatgaacttgaaatggggtgcaccaaaagatgat
ggtggatcggaaataactaactacattcttgaaaagagagattcagtgaccaaaatgtgg
gttacctttgcctcatctgtggagatgtgtaatttcagagtaactggtcttcatgaagga
actgaatacatctttagagtttctgcagaaaacaagtatggggttggagaaggcctcaaa
tcggatgatgttgtggctaagcatccatttaacgtaccagatgctccaccaccaccacag
attatggctatgcgatgtgattcagcggtattagcatggtctgatccaagaaagactgga
ggctcaccaattacaggatatcatattgagttcaaagaaaggaacagtttgctgtggaag
agagcaaacagcacaactgtgaaaatgaaagattacacagtaattggtttatcagaaggc
cttgaatatgaattcagaataatggcaataaatattgcaggcattggaaagccaagccca
gcaacagagcctgtgattgccttagaccctatcgatccccctggcaaacctgatgtaatt
accatcacaaggagcacagtaactcttcagtggactgaacccaaatatgatggtggacac
aaattgacaggctacattgttgagaaacgtgaattgcctgcaaaactctggatgaaggca
aacatcataaatgttttagattgtgcttttactgtaacaggccttcaagaaggctgcaag
tttgaattcagaataagagctaaaaatgcagccggagcaataagttctccgtcagaacaa
actgacaccattgtttgcaaagatgaatacgaagcaccagccatcatcattgatccaact
gtgaaggagggccttacagttagagctggggatacaattgtgataactgcaacacgcata
actgggaaacctcctccaacttctgtctggtcaaaaggaggaagggacttcaaaccctca
gatatctgccaaattgaaaaaaccccaacatcttcaacactgacaataaagtgtgccagc
aggaaggactctggagaatacactatctctgccagcaatccatttggaatcaaagaagaa
aatgttaaagtgacagttcttgatgttccaggccctccaggactgcttgaagccagcagc
gtttctgctgaaaaggtcacattaacatggtcaccaccacatgaggatgggggctctcca
gttaaatcatatacgctggagaagagagaaacaagtcgacttctttggaccactttagca
gaaaatattattgattgtcattttgttactaggaagctcatccaaggcaatgaatacatc
tttcgcgtttcagcattaaatcaatatggcactggtgaagcaacacaatctgagccagtg
aaaatggtggacaactttggtccaccaggtcctccatccaaaccagaaactgttaatgta
gataaggactctgtcaccatttcatggaagagaccagttgaagatgggggtagtgatatc
attggctatattgttgaaagaaaggaaaaaagagagatgagatggattagagcatcaaag
aaaatgatttctgatctaaattacaaagtccaaggcctcatagaaggagttgaatatgaa
ttccgagttattgcagagaataaagctggctttggagaaccaagtgaaccttcacaatca
gtcataacaaagggtatgacatatgtgcctgggcctccattcaatccaaggattactgat
acaactaaatctacagccacattcacttggagcaggccactgtatgatggtggacttgac
atcactggatatataattgaacacaaaaaggaaacagagacagagtgggttaaagataca
gtgggcactctaagaattactgaatttgttgtttcgaatttacagcaaggaggaaggtac
aatttcagagttagcgcaatgaatgcaaagggtgtcggtgaatcagctcaagttgaagaa
cttgtggaggttgtggaacgccaagaaattccagactttgaacttgatgccgaacttagg
cgaacccttgttgtgaaggctggaggatctatacgtatatttgtgccgatcaaaggtcgt
ccaatacccaaagtcatttggatgaaagaagaggcacttataggtcgtgcacacattgat
accacagaatcatatagtcttctagttatcccagactgtacaagacatgatgctggaaaa
tacatgttaagattggagaataccgcaggcaaaaaaacttgttgcgtgaatgttaaagtc
ttggattccccgggtcctcctctcaacttgaggcccacagcaattaataaagaaagcatt
accctccaatgggaaacacccattattgatggtggttcaaagataacaaattacatcatt
gaaaagcgtgaagctacaagaaaagcatatgttgccataatcactaattgtcaaaaatgt
tctgttagagttccaaatctggctgaaggatcagaatatttttttagagtgcgtgctgaa
aatgaatttggaattggtgaacctgttgaaactccaaacccaattagagtgtctcaagca
ccagctgctccggaaaaggttaatgtcacagacattactaagaattctgcaaatcttacg
tggacaaaacccaaacatgatggtggaagtagaattactgcatatgtcatagaagctcaa
aagaatggctcggagcaatggtcccatataactacattgaagaatctagactatgtagta
aaaaatctaaatgaaaatgaagagtatgtgttcagagttatggctgtcaacaatgcagga
agaagtgacccatgtgaaagtaggcctgttgttattaaggaagaaaccacacaacctgaa
tttgatttacgtggaatctgccagaaattagtaattgtgaaagcaggagatgatctcaaa
gttgagatacctgttctagggtgtccaaaaccagctgttacctggaggaaggaagaacag
attctcaaacagacgcaaaggataaatattgaaaacacttcaatttcaactaccctcaat
atcagagaatgtactaggaatgacagtggacagtactctgtgacaggaaaaaatatactt
gggactgtgaccgaaacaattaccgttaaagtacacgatattcctggacctcctaggggg
ccagtaaattttgacaaaatttgttgtgattctattgtaatatcatgggattctcctgaa
aatgatggaggagtaccaataaacagttatgttgttgaattaagagaaacaacaagtaca
ttatgggtaacattatcagcaacagtaatccgtacaatgttcaaagcacagcatctttcc
actggagttgaatatcagtttcgtgttaaagctaaaaacagatatggtgttggacctcca
ataaactctgaatctgtcattgctacttatccttttaaggtacctggcccacctggcaca
ccaaaagtaacaggctttactaaaaacactatgacaattagttggaatgagcctgtgtct
gatggaggaagtgaaatcattggataccatgttgaaaggaaagagaggaagagtattata
tggcacagagtgagtaaaggactggtagtaggaaatatttttaaaactacaggactagaa
gatggaattgcatatgagtttcgagttgcagctgaaaacttagctggagtgggaaaacca
agtaagccttcagaggcattctttgcccttgatccagtggacccaccaggtcagcctgtg
gccataaacatttctaaatcttcagtgactattcagtggaaaaagcctgaatatgacggc
ggattcaaaatatccgggtacacagtggaaaagagagatttacctgatggacgatggctg
aaagccaacttcagcaatattcttgacaccacgtttactattagtggactgacagaacat
tcctcctatgaattccgtgtttttgcaagaaattcagctggtgctgtgagcaatccatct
gaaccatcggatcctattgtttgcaaagatgacattgaggagccaagaattatggttgat
gctaagtttaaggatgttttacttacaaaagcaggagaagtcttcaagcttgaggctgat
gttacaggtcaaccattacccttcttgatttggaccaaagatggaaaggaaatagaaaat
acaacaaaagttgaaatgaaaaaaactgatttaactacagttttaattaacaaggactct
ttaagaagagatgggggtgaattcacattaactgcaagcaaccctggcggttttgccaaa
catgtcttcattgtaaaagtgttggataggccaggtcctcctcatggtcaactagctgtt
acagacatcacagctgagaactgtgtcctgtcatggttaccacccttagatgatggtgga
gcaaagattgaatactatgtacttcagaaacgtgaaacaagtaggcttgcttggacaaat
gtagcttcagacttacaagtcaatcaattcaaggtaacaaagttgctgaaaggcaatgag
tacatctttagagtcatggctgttaataggtatggagttggcgaacccctagaatctgag
ccagttgttgcagcaaacccatatttgccttctgatcctccatcagctcctgaggtaatc
actataactaaggactcgatggtaattagttgggaacatccaaaaaacaatggtggcacc
aatatttccaactatattattgaaaggagagatagagcaggccaccgctggattaagtgc
aacaaaaacattgtaactgatgtgaggtacaaagtaacaggactgatacaagggcatgaa
tatgaattcagaatcatagctgagaatgctgccggtttaagtttcccaagtccctcaagt
cccttttataaggctagtgacacaatttacaaacctagccctcctggtaatccaagggtt
ttggatacaacaaagtcatccattacacttgcatggaacaagccggtatatgatgggggt
tctgatatcactggatatgttgttgaaacctgtcttccgcatgaagatgaatggacagtt
gtcactcccaaggaaggtttagtagccactgtatttacaattactaacttaaaagaaaat
caagaatataaaataaatatttcagctgttaattgtgagggggttggagaccctgcctct
gttcctgggttaccaaaagcagaggatagacagattccaccagaaattgaacttgatgca
gagctccgtaaaattgttaatataagagctggtggcacattaagaatttttgtacctatt
aaaggaaggcctgctcctgaggttaaatggtcaaaacaaaatggagagccactggatagg
gccattattgaaagcacaacatcctttacatcaattttagttgaacatgttaacagattt
gatagtggacagtacattttaatgttggaaaacagctcaggaagcaagacagcctttgtg
aatgttagagtactggatacccctggagctccgcaaaatttcaaggttaaagaagtaacc
aaagaatcagtttcactcacctgggatcctcccattattgatggtggtgctaagattaag
aactacattgtagaaaaaagggaatcaacaagaaaggcatactcaactgtaaatgcaaac
tgtcacaaaacaagttggactgttgatcagctgcaggaggggtgcaactattattttagg
gtttttgctgaaaatgaatatggaattggtcttcctattgaaagcagtgactcagtgaaa
gtgtctgaaaaaccactccctccaggtaaaatcacgttgcaagatgtaacaaaaaacagt
gctacactgttgtgggaaaaaccagaacatgatggaggaagtagaatagttgcttatgtt
gttgaaatgcagggtaagcgcagtgaaacctggacccagtgcatgcttgtaaaagccact
gaagcggttgttactgggctgacagaaggtgaagaatacatcttccgtgtttcagcaaga
aatgagaaaggaaccagtgatcctcgtcagattggtgtaccagttattgctaaagatctt
atcattaccccatcagtaaagttattattctcaacatttagcgttcttgctggagaagac
ctaaaagtagacataccatatcttgctaggcccaaagcagctatattatggcacaaagat
ggttgtcctcttaaacaaacatctagagttaattttgaaatggatgaaagccaactgtat
ctcaagataaaagaagcttgtagagatgatgttggtcagtacaccattcaactttcaaac
actgctggggaagcaacagcaaacatttgcattgttgttcttgataaacctggtcgtcca
ggtggtccagtaaaaataaccgaagtcacagctgacagtgttacgttgtcttggaatcca
ccagaatatgatggtggttgtactatcaacaactacactgtggagaagagagatacttca
agtacaaactggcaagctgtaaatgtaagcttagctagaacaacagttaaggtaagacgg
ttgaagactggttgtgaatatcagttcaggataactgctgcaaatcgttatggaaaaagt
cctggtctagtttcagaagctgtacttgcccagtacccgtataaacttccaggccctcca
ggaacaccatttgtacaggaggccaataaagatagcatggttgtggtttggaatgaaccc
gtgattgatggaggaacaaatatcctggggtatcacctggatcggaaggaaagaaacagt
attatttggatgaagctaaacaagacattaattcaggacctggagttcaaaacaactggc
cttgaagaaggaattgaatatgaatatagagtttatgcagaaaacattgttggcataggt
aaacccagtaaagtttcagaaagctatgttgcaagagatccttgtgatcctcctggtacc
cctgaagtagctaccatcacaaataattcagttgcacttagatggacaaagccagagtat
gatggtggattcaaaattactggatatgttgttgagaagaaagagttacctgatggtcgc
tggataaaagcaaatttcacaaacgtgattgagactgaatatgttgcaactggattaact
gagggtcagaaatatgagtttcgtataattgcaaaaaatgcagcaggtcttctcagtgat
ccctcaaacagcactggtcctattactgcaaaggatgaagttgacccgcctcgcattagt
atagatccacaatatactcaaaaatttgttgttaatgctggagaaaactttaagattgct
gctgacgttcaaggaaaaccaacaccattaatctgctggatgaagggaaatcaagagctt
ttcaacactaaatggtgtgaaataaaaaacaccaacagtagtacatgtcttagtgttaag
gatgttaagcggaatgatggaggccagtacactctaaaggtggaaaatactggaggacag
aagtctgttcatgtcaatgtagaagtcttagacaaaccaggtccacctgagggacccatt
tctgtgtccaatgtaacagctgaacagtgtatagtcacctggaaaccaccaaaggatgat
ggtggcagtgaaatacttcattacattattgaaaaaagagaaacgagtagattagtatgg
actactgttgagcctaaaataaaagaacttgattttaaaatcacaaaacttcttgaagga
aatgaatatatatttcatgtcatggctgtaaacaaatatggaattagtgactcactagaa
tctgaagctgtaattgctaaaaatccctttgtaactccaggcgcaccaaagaatgttgaa
atttccaatgttacaaaagattcaatggttgtaacctgggaggcacctgctaatgatggt
ggtagcccaataacagggtatattattgaaaagcatgacaaagaaggagtaagatggaca
aaatgtaataaatgcacagtaactgaattacacttcagagttactgggcttctggtaaac
caccattatgagtttagagtttcagctgagaatgctgcaggagctggagaaccaagctcg
ccatctccttactataaggctttggatcctattttcccaccaggccctccaaacaatcct
aaggtcactgatataacaagaacctcaattttcctttcctggggaaaacctgtttatgat
ggaggttgtgatattcaaggatatattgttgagggatgtgaattaacatctgaagaatgg
aaaatgttcactccatcaccgggtattaaatgtgcacagtttgaagttgataaactaaaa
gaaaatcatgagtataaattcagagtgtgcgctgtaaacaaagttggtgttggagaacat
gccgatgtgtctgccgtgctccttgaagacaagagagaagagccagatcttgatattgat
cctgacctcaggaagacactcactgttagagctggagcctccatcagagtgttcattcct
attcgaggacgacctgctcctgaaataaaatgggggaaagttcatggtgaaattagggat
acagctcaaattgagattacaagcagttatacttctcttgtcattgataaggttaacagg
tttgatagtggaaagtacaccattactgcagaaaattctagtggaacaaaaactgcatct
atcagtgtcagagtgcttgatacacctagtgctccagttaaccttaaagttaaagaaatg
acaaaagaatctgtaacacttacatgggaaccaccttcactggatggtggagctaaaata
aaaaactatattattgaaaaacgtgaaacaaccagaaaagcatactcagctgtttcaacc
aactgtcacaaactgtcatggaaaattgaacctcttcaggagggctgtagttattatttc
agagtatatgccgagaacgaatatggaattgggttaccttcagaaatacccgatccttta
aaagtttcagaagtgccccaaccacctgggaaacttacagttgttgatataacacgtaac
agtgtttctcttgcttgggagaagcctgaacatgatggtggaagcaaaattcttcattat
ctggtggaaatgcaagctaaaggcaatgaaaagtggtctgtaagtgcaaatgtaaaaaca
ctggagactgttatcactaatttagttcctggagaagaatatgtattcagagttgttgct
gtcaatgagaaaggaaagagtgacccaagatcccttgcagtaccagtacagacaaaggat
cttgccatagagccagatgtacgacctgcatttaataactacagtgtgctggttaataag
gacctcaaattagaaataccaatttctggatgtccaaaaccaaacattacttggaaaaag
gatggcttaactcttaaacagacaacaagggttaatgttatcaacacttcaaagcaaaca
attcttaatataaaagaagtaacaagagatgatgctgggatatatgctattgctgcttcg
aatgctgttgggaaaaaagatgcaaccattgaaatcattacacttgataaaccaggccca
ccaactggtcctattaggtttgatgaggtcagttcgcaaagtgttacaatttcctgggat
ccaccaaaatacactggtggctgtccaattttaaactacattgtacaaaaaagggacaca
accactactacctgggaaaatgtttccacaacagcaataagaactacattgaagatattg
catttgacaactggggcagaatatcaatttagaattattgctgaaaacaggtatggcaaa
agttatgccttagactctgcatcagtgattgctcagtatcctttcaaagaacctggacct
ccaggaactccctatgtttcctcactttcaaaaaatcacatgattgtggagtggcatgaa
ccagtatcagatggaggcagcagtgttgttggatatcatcttgaaaggaaagagaagaat
agtattatctggacaaaaataaataagacactaattcgtgacacttcttttaaaagcact
cctctagatgaaggtattgaatatgagttcagagtttatgctgagaatattgtcggcatt
ggcagatgcagtaaaatctcagaggggtatgtggctcgtgacccgtgtgatccacctggg
actccagaagtcacctctgtgactaaaaactcaatcacagtccattggacaaggcctgag
tatgatggaggtagtatgattactggttacattgtggagaagagagacatacccgaggga
cgctggataaaggctaacttcacaaacataattgagacccattttacaattactggcctt
atagaaaactgcaaatatgactttagaattattgcaaaaaatgcagttggaactattagc
aaaccatcttgcaatactggaccaataactgcaaaggatgaagctgagccaccaagatgc
tcaactgatccagagtacattcaagctattgtagtaaatgcaggggaaagtttcaaactt
gaagctgatgtttacggaagacccatgcctacaattcagtggttcaaagatgataaggaa
attgaaaattcatcgagatgtgagataaaaaacactgaatctcgaacaatggttactgtt
aaagatgccagcagaatagacagtggccaatataatttgcaagtgacaaatgtagcaggt
tccaaaactgttccattccacgttaaagtactagatgtaccaggaatgtgtgaagggcct
ctagatgttaccagtgtaacttctgaaacatgcacattatcttggcttcctccgaaacac
aatgggggaagcagtatttttcattacataattgaaaggagggaaacgagccggctcgca
tggactgtagtttgtagtgactgtgaagatacattgtttaaagtaactaatcttctagaa
gggaatgaatataaattccgtgtcatggctgtcaacaagtctggtattggcaaaccacta
gaatcattaccagtgataatgaaaaatcaatttttaccacctgaagcaccacaggcttta
gaagtaattaacattgcaaaggattccatgactgtttgctggaagagaccacaaatagat
ggtggaagtgaaattattgggtattttatagagaagaaagagaaaactggagtaagatgg
acaagatgtaatagacaaattgtctcagatttacgtttcagagtgacaggattaatggag
gatcacgactatgagttcagagtttatgcagaaaatgcagctggagttggagaaccaagt
ttaccaaccccttgttataaagcttgcgaccccatgttcagtcctggtccaccaacacat
cctcatgtaactgatatcacaaagaactccatttcattgacatggggtaaaccaatttat
aatggtggcagtttgatccagggatatgttgtggagatctgcaaagctaatgaagaggaa
tggacaatgtgcacaccaccaactggcctacttgtcaataaatttaatatcacaaacctt
tcagaaaatgatgaatataaaattcaggtgtgtgcaatcaataaattaggtgttggtgaa
gcagctgctattcctggtacagttaaacctgaagacaaaatggaaccaccagagctctcc
cttgactcagaaataaggaaaggacttatagtgcatgctggtaggtcagtgaaaatcagt
gtccctttcaaaggaagacccattccaaacattagttggactaaagaagaagaagatttg
tgtaaaaaggaaaaagtaaaaattgaaaatgggattaactgtacgcaactttcaattgaa
aactgcaacagaaatgacactggaaaatatactgttaaactggaaaacagcagtggttgt
gtatcagatttcatctccatcaaagtattggatacaccaggagcacctcagaatcttgtt
gtgaaagatataaaaaaagactgcatcactcttttgtgggagccaccactttcagatgga
ggagcaaagataaggaatttcatagttgataaacgtgaatcaactagaaaggtgtatgta
aatgttactgctaaatgcaccaaaacaagctttaaggtagaaaatcttgctgaaggcgct
atgtattactttagagttatggctgagaatgaatatggagttagtcaacctattgaaact
aaaagtgcagtaagggtgtgtgaagttcctctgtccgtgaggaatgttactttgactgat
gtaactaaagtaagtgcctccctagcatgggaaaaaccagaacatgatggtggtagtagg
ataatgggttatgcaattgaaatgcaggttaaaggaacagataaatggactgttgcaaca
tcaacaaagacatgcgaaggtactgttgcaggactaatatctggtcaggaatacctcttc
cgtgttttagcctacaacgaaaaaggaaagagtgatcctaagatattagctacaccagtt
actgcaaatgatttaactgttgaacccagttttaaactattgttcaacacttatagtgtc
aaatctggtgatgacctcaaaatagaaataatggtgactggatgcccaaaacctaaaatt
acatggatgaaagatggactatccctaaaacagactacaaggattaatcccattaacaca
cctacatcaacaatccttcagattaaggaggcttgcaaagacgactttggcaaatattct
gtcacagcaacaaactgtgcaggtgattcaaaggaagaaattgtcataatagtctttgac
aaacctggtccaccaacaggtcccattcaaatcaatgatgtaactaataattctgtcaca
gtatcatgggaaccaccggaatacaaaggtggctgtgaagtaaagaattatgttattgaa
aaacgggacacagctaccacagcatgggaagttatatcacaaacagttgcaaggacaact
ataaaaatttacaaacttaaaaaaggttccgagtatcagtttagagtctttgctgaaaac
agatatgggaggggttctcccttgatttctaaacctgttgttgtgcagtacccttacaaa
cctccaggaccacctggcactccatttgtcacatcaacaacaaaagactgcatggttatt
gaatggaatgaaccagttactgatggtggcagcacagttattggctaccatcttgaaagc
aaagaaagaaatagtatcctctggactaagttgaacaagactctaattagtgataccatc
tttaaggcatgtaaccttgaagaaggcaacggatatgaatacagagtgtttgctgaaaat
attgtaggcattggaaaatcaagcaagatttcagaatgttttatagctcgtgatccttgt
gattcacctgggacacccgagccagtcattatatgcagaaaccatgtcacacttcagtgg
atgaagccacagtatgatggtggtagcaaggtaactggatacattatagaaaaaagagat
ttacccgaaggtcgttggatgaaagccaacttcacaaatgttgctgagacagaatttaca
gtcacaggattatcagaaggtgaaaaatatgaatttagaataattgcaagaaatgcagct
ggtattttcagtcaaccttctgaaagcactggaccaatagctgctaaagatgacattgaa
ttgcctagagtgtcaatggatccaaaatacaaggatgttgttgttattaatgcagggtgt
actcttgctcttgatgctaatgtgtatggaaaaccagaacctgatgtcatatggttaaaa
gatggaaagaaatttgaagtgactactcaaaaagttgacataaaaaccactagtaaatcc
acagtacttatagttaaggactgcactagagaagacagtgggtgctacaaccttattcta
agcaatattggtggaacaaaaactattccaattactgttaaagttcttgacaggcctggt
tctcctgaaggtccactacaagtgactgaagtcactgcagatgcatgttgtctgtcttgg
ggagaaccattacaagatggtggtgcagctgttgaccattatattgttgaaaaaagagac
accagtaagttgtcttggacagtagttaaacccaaagttaaagcacttagctgcaaagtg
acaaatctcctagttggaaatgaatacatcttcagaactatggcagttaacaaatatggt
ataagtgaacccttggagtctgagcctgtaacagcaaaacatccgttcaagcctccaagt
ccaccatccatgcctgaagcaacttgtataacaggggattcaatggttattaaatgggaa
cagccagagtataatggtgggtcagatattcataactatcatcttgagaaacgtgacaaa
gatggtgtcaggtggacaaaatgtaacaaaacagaactaagcgatctaaatttcaaagta
actggtctcacagaagggcatttctatgaattccgggtctctgctgaaaatgaggctggt
gtgggtccaccaagtgagccatctttgttctacagagcctgcaatgctgcacgtccacct
ggcccaccaaaccatcccaaggtcactgatcacacaagctcaactgtgaccttatcttgg
agcaaacctcttgatgatggcggtgcatacataaagggatatattgttgaaatgaaagag
gttacacatgaagactggagtacttgtacaccttcaactggtatacaagcaacacaatac
aaagtggaaaaacttaaggaaaatactaaatacaactttcgcatctgtgcatttaatgca
gaaggagttggtgaacatgctgatatccatggctccatagctgctgttgaaaagcaagaa
gtaccagaggctgaattagatgcagaactcagaaaagtcgtttctgtacgtgcaagtgga
acacttcgaatttttgttgtcatacgtggaagacctgaaccaaaagtcaagtgggagaag
gcagaaggatccctgactgaacgtgcacaaactgaaactactagttcatacaccatgttg
gtcattgacaacgtaaacagatgtgacagcggcaagtatattttgacccttgaaaataac
aatggcacaaaaacagtatttgtcaatgtcagagttatggactcaccaagctcacctctt
aattttgtaatcaaagacatcaagaatgattcagtaacactgtcatgggattctccagct
tttgatgggggagccaaaataaccaactacatcatagaaaaacgagagtctacaagaaag
gcatatactactgttacgagtaactgcacttcaaattcatttgtaattggtcagctgcag
cagggaggtatttattatttccgtgtgcaggctgttaatgagcatggtgttggtttacct
gcagaaactaaagacccagttaaagtttctgaaccacctatgccaccaggtaaaattaag
cttgtagatgtgactcgtaacagtgtaactctttcttgggagaagccagataacgatgga
ggaagcaaaatcatatgctacaatgtagaaatgcaaactaagggcagtgagaggtggatt
gcaaccggtacatttagggcactggaagcaataattacaggtcttgtaccaggtgacgaa
tattctttcagaatcagtgctgtgaatgaaaaaggaacaagtgaaccaaaacaactaggg
gttcctgtcattgcaaaggacattgaaattgagcccaccattgatatgccttttaacact
tacagtattaaagctgggaaagatttaacagttgaagttccatttaaaggtagacccaaa
cctgtcatatcatggaagaaagatggtcttcctttaaagcaaacaacgtcagtgacactt
ttatcatctatgacctcggcaaaactttttttcaaagaagccagcagagagcatgttgga
aaatatgaaatcacactaactaatgcaggtggtacaaaaacagaagaaattttaattgtt
gttcttgataaacctggttctccagctgcaatcagagtggatgaagtaactgctgaaagc
atttcattatcttgggaaccaccaattttcaatggtggttgccatatcaacagctatatt
gtagaaaagagagatgccaacaccagtgtatggcaaattgtttcatcaacagttgctaga
acttctattaaagtatcgcacctgacacaaggctctgaataccagttccgtgtttatgct
ataaatcgttatggaaagggtccttcaatagattcgccagtaattactgtccagtatcca
ttcaaagttcctggtccccctgctacacctcgggttgtccaagcaaccaaggaattcatg
cttgttacatggaatgaaccagttaatgatggtggcagtgcagtcactgggtatcacctg
gaatgcaaagaaagaaatagcattctttgggcaaaaataaacagaagtctcatcaagaat
acagaattcagagttactggtattgaaaagggcttgttctatgaatatcgtgtctatgct
gaaaacattgttggtgtaggaaagtgtagcaaagcctgtgaacctgtggctgcaagagat
ccttgtgatcctccaggtcaacctacagtcacaaacatcactaaaacagccgtttcactt
ttatgggcaaagccacagtatgatggtggagctaaagttacaggctatatcattgaacgc
aaggaagaggaacgctggataaggtgcaatttcaccaatattcaggaaacatactttgat
gttacaggccttgtcgaaaaccagacatatgatttccgtgtcattgctaaaaatgcagct
ggattatttagtcaaccatctgattgcacagggcccataacagttaaagatgatgtagat
ccaccacggatcataatggatgttaattttagaaatgcagtagttgtaaaagctggagat
tccctgaaaatcaaagcagatattgctggacggcctctcccagttgtttcatgggcaaag
gatggtaaggagattgacatgagggctagaatacagatctattcaacagacaccagcact
tcagtaaccattaaagactgtgtaagaagtgactctggtcagtatgttttaacagtgaag
aacctggctggaacaaaatcatttcctctaaactgcacggtccttgataggccaggacca
tcagcaggtcctttacaggtgactgaccttactgcagcaacatgtacattgacctggggg
ccccctcaagaaaatggtggagcggaaatctcccactacattgttgaaaagcgtgaaaca
agccatcttgtctggactgtggtacattgggacataaaaactacaacatgtaaagttgac
aaacttcttaaaggaaatgagtatatatttagagttctaggtgtgaacaaatttggagtt
ggtgaagcattggaaagtgatcccataaaaacaactgatccatttactgtcccatttgca
cctacaaatgttgcgattagcaatgtaagcagtaaggaaatgacaatctgctggggaaag
cctgcatctgatggaggtagtgaaattcttggttatataattgaaaagcgtgagaagtca
agtatgcactgggtccgtgtgaacagtaagcttatatacgagctttcagttaaagcaacc
aaactccgtaacagatgtgagtatgagttccgtgtttttgcagaaaatgctgctggtata
agccttccaagtgacccttgtccattaaccaaagcagaagatccaccgttgttgccacct
tctcctagtaaaccaaaaattattgattcaaccaaaagttctatcactcttttgtggaac
aagccacaatctgttggtgagaatcctgtcactggatacagcatagaatttaaaaagaaa
agtgataaagaatggcgtgtggcagttcagaatacaaggaatactgaatatacagttagt
ggacttgaatctggagcagagtatgtgtttgctgttaaatctattaacaaaattggtatt
agtgacccaagcccaccatctgaccccgaagttgcaaacgagagagaagaagagccatta
tttaatgttgacaatgaaatgcgaaaaacactcattgtcaggcatggaaattcatttact
ctgactgcaccattcagaggaaaaccaattcctacagttgtttggaataacgaagatgta
aatttgcaggagagagcaagtattgatacaagtgataattgtacatcacttacaatagaa
aaagcaacaagaaaggactcaggaaagtatactgtgacactagagaacccagttggaact
gctgtactaacaatgactgtcaaagtccttgattcacctggcccaccttcagacattgaa
attaaagaagtgacaaaggactcagtaactttgacatggagagctccagacaatgatggt
ggtgaccctgttaaaaattaccacattgaaaaacgtgaagcaatcaaaaaggcatgggta
agcgtgacaaacaactgccaccatcttatttacaaagtgacgaacttacaagagggagcc
atttattacttcagagtcataggtgaaaatgaatttggacttggagtgccttcagagaca
gacggaactaaaattacagaaaaaccaagtacccccacaaaacttggagttactaatgta
acaaaggatagtgtttccctggcttggagtaagccggagtttgatgggggaagcagaata
accagttacctacttgaatcccttgaaaagggacaaaagaagtggattaagtgcgctgtt
gtcaaaaccactgaccacgtggttcatagtcttagggaaaatgctgaatatttgttcaga
gtgagtgcagaaaaccatgctggtctaagtgaacccaaagaaatgattacacctgtcatt
gtaaaagataagcttgaatctcctgagtttgacatgaagaacttcagtcgtaatactgtc
tatgtcagagcaggatcaaatctcaaatgtgagatccctcttactggaaaacctctgcca
agagtcaccctttcaaaagacagtattattatgaaatcagcaaagagatttaaatttgaa
gtcattccagaaagcttgttgattaaccttaaagaaagtattgctagtgattctgggagg
tatgacattacagcttccaactcatgtggagtcgcaaagacctttgtaaacattttggtt
ctggacagacctggtcctccagttgggcctgtggaaattagtgatgtcactgaagacagt
ttatgtctgaaatggtttcccccagtatatgacggtggcagcccagtaacaaactacgta
gttctcaaacgtgaaacaagcactcctgcatggatggaggtttcatctacagttgcaaga
agtgaaataaagattactaaattgatgaaaggggaggaatatcaattcagaataaaagca
gagaatcgctttggattcagtgatcacattgactctaaggctgtgacagcaaaactccca
tacaccacccctgggcctccttcgactccttgggtaactatggtttcaagaaacaatatt
actgtttgctggcatgagccagtatcagacggaggaaatcctgtttttggataccactta
cagatgaaagatagaaatagctctgtttggcagaaggttaacaaaactgctatccgtgcc
actcagtttagagtgacaaacatatgccctggactcatctacgagttcaaagttgctgca
gaaaattcagctggcattggcaaaatcagtaaaacatcagatgaagtccttgcaattgat
gcttgtgagcccccaggcaatgtgcgtatctctgatatcacaaagaactccattaccctt
gtctggcagaagcctccttatgatggtggcagtaaagtcacagggtatattgtggagaag
agagatgcatcaaaatgtagatggacaaaagcaaacttcacaaatgtcattgagactaat
ttcaccatatctggtttgacacaagatgagtcctacgaatttagagtttttgcaaagaat
gctgcttctgtcagtaacccatctgttattgctggacctgtaaaatgtgtagatacccaa
ggtactcctgagattgacctgccagcagagtatctggatgtcctaaattataaggctgga
gaagtagtccagattcaagtgggaatcaaagctaggccactacctgtaattgagtggttc
aaggatggaaaggaatttttatctagtgctcagatatctattgaaagcactacagatgcc
tcaggaattatcataaaggatgccaatcgttttcacagtggaacctatgaagtcaaaatc
aagaacgctttgggcctggcatcagcttcagtcagagtacagattctagacatacctgga
cctccagttggacctgttcaattcaagagagtaacagcagagaacatcaccattgcatgg
aatcctccaatagatgacggtggtgcaaatgtcacccattatgttgtggagaaacgggag
acaagcagaactgcatggtcagttgtatctgaagaacacaaggaatgcacaatatcagtg
gagaaattagtgagagggagtgagtatgtctttcgtgtacggggcatgaacaagtatggc
attggagaacctttggaatctgcaccagttattgccaagaatgcatttgttacaccagga
caacccagtacgccagaggcgattaacattactagatcaacaatgactgtggtttgggag
agaccaggtgtggatggtggcagtgacatcactggctattacttggaaatgcgtgataaa
aacaccctacgttggcagaaagtcatgaaagctcctgtttgtgacaccataaagaacatc
ctcaaccttacaggaggaaaagaatatcagtatcgtgttaatgcaatcaatcgtgcagga
gaaggtccatactcagatgtctctgatttctacaaagcagttgatcctatacaaccacca
gatgaaccaaacaaactgaaagtagttgattcaacaaaaacatcaattacacttggttgg
ggaaagccagagtatgatggtggcagtgaaattacaagttatgttgttgaaaagagagtc
gctgaagaagaagaatgggtggtgattagctccaaaggtgaaattagaactacagaatat
gttgtatctcatttacaacctgaaactgactacttcttccgtgtgtctgctgttaactgt
gctgggcaaggaaaaccaattgaaatagttgaacctgtgcaagccaaggatattcttgag
gaagctcagatagattctgatattgcactgaggactcaatatacagtgaaggcgggaaca
gatgtggaaataatggttccatttaagggaagacctgtgccaaatgtcacctggaaagta
gatgaaacagacatatgtaatgatccaaaatacaaaattcacaacaatgaatcttcaact
ctccttatcattccactggttactcgtaatgacacaaacaaatatattcttgaacttgaa
aatggtgttggggagcccaagaaagtaacaatatttgttaaagtgctagatacaccatca
gtttgccaaaaattacaaattaagaatgtcactcgtggaaaagtaacactgagctgggaa
gaacctcttcttgatggtggtgcaccagtaattaattacatcattgaaaagaaagactct
gcaaagcgatcatatacttctgtaacaaccaagtgtgccagcacaacatatgaaatcgat
aaactttctgaaaaatcatcatattttttccgcgtgtcagcagagaatgaaaacggaatt
ggtgatccctgtgagactgcggaacctgttaaagccactgagataccaggtcaggtaaaa
aatatatccatgaaagattccaccaaaacatcggtgacactgcagtggagtaaacctgac
tacgatggtggcagcataatatcagactatgtaattgaaaagaaactgaatgatgagaag
gactggacatttgtaggcaccagcagaacatgtgaatatgaagtgacaaagcttaaggaa
ctagcagccatcgaatttagagtttgcgccaaaaatgagaagggacaaggagacttcatg
caaattggacccatcatagtgaaggactttattattccaccccatgcagatctatcagag
tacccgggaggtcaaataagtgtgcgtattgggcacaatgtccatattgagttgccatac
ataggaaaaccaagaccaaccgttgagtggttaaaagacaacctgccactgaaggaaagt
gaacaggttcgctttaaaaagacagcagacaaggttactctcatgatcaagaatgtaaga
aagaaaaatgggggaaaatatacattaattcttgataacaagttttgcagaaaatcattc
tgcatcaaagttgttacccttgggccacctgcaaagcctactggccccattgaaatggat
gaaatcagagcagagagcataacaatatcttgggatgagccaagtgatgatgggggtgga
gaaattatttgctacagtgtggagaaatgtgataattcccagacagactggaaaatggtt
tgctcaaatgtaactgggacaacatataaggtacccaatttagttaaaggaacagggtat
cagttcagagtatgtgctgaaaacagatatggtgtgagcgagcccttgatttcgcagaca
gtgcttgccaaacaccagtacagaccaccaagccccccaggaaagccagtcgtttacaat
attatgcatgacagcatgactattcgatgggacgcacccattaatgacggtggttcggca
ataattggctaccatgttgacaagaaagagaaaaacagcatcatgtggcaaaaagtaaac
acggtaataataaaagacacaaattacagaattattggcctcattgaaggactggaatat
caattcagagtatatgcacagaatgactctgggattagtaaagtcagtgaggcaagcaaa
ctcaccactgctgtctcacctgttgatccaccagggcttcctgactacattgatgtgaca
agtgattctattacactgaaatgggatgctcccaagaatgatggaggcagtaaaattgta
gcgtactatgtggaaaaacgtcaagaccaaggtcgctggttgaagtgcaactttattgat
gtttcagaatgccagttcacagtaactggtcttagaagtggtgatcgatacgaattcaga
gtgattgcaagaaatgcaattggaacaattagtccaccttcccagtcttctgggtatatt
ctagtcagagatgaaagtattgctccaaacattgaatttggtaaggaatattttgagggt
ctcacagtcagagctggagataatatcagacttaaagccataatcactggacgacctgca
cctcaagtcacttggtttaaaggcagaaaggaaattgacaaaaagacaatgattgatatc
acaacagtcactggatcaagctctctctttattagagatgctgatcgcaaccattgtggt
atatatagtgtggaagctaagaatatctctggaaggaaaaagcaggacattactgtaaag
gttctagatgtgcctggagaaccaattggacctattacgtttacccatatctcagaagag
aaagcaaccctctcatggaatccacctgaaaatgatggatgcgctcccatcaagcattac
ataattgagaagcgtgatccctcaaaaattttatggacacttgttacggaccagtgtgaa
gtctgcacatatactgtcactaaattaatcaaagacaatgagtatcagtttcgtgtttct
gcagtcaacaagtttggtgctggcagaccactagagtccactcctatcaccgcaatgatg
ccatttgctgttccagatgctccaggtgcccctgaagctaccagtataactggacatagc
attacactgtcctgggaaataccaagctctgatggagggaatgaaatcaaatattacatt
ctggaaaaacgtgaaaagaagaacatgcgctggatgaagattttatcaaagaaacccatc
actgagcctacatatacagtaacaaaccttaccgaaggttgtttatatgaatttcatgtc
atggctacaaatgatgctggaattggaccagccagcaatgcatcagcacttataaaatgt
agtacgccaacaagcactcctagtgctccaacagtactgaaagcaactgattctacaaag
acatcagtcagtctggaatggacaacacctgtattcagtggtggtatggagatcactggt
tacattattgagatgtgcaaagtaaactctcaagaatggcaaaaaataaatgtagaaaac
tgcacaaaaacaaagtacactgcaactggtttagattcaaacgaagaatataagttccgt
gtctgtgcagtaaatggagttgggaaaggagaggcctgtgaaattcttgaaccagttcgc
actgtggatagacttgcatcaccagaaattgacattgatgcaagcttcaaacagacacac
attgtgagaaacggaggcactgtccgcctttatgctgcttttaagggaaaacctcctcct
gttgctacatggaccaaggcagatggagatttcagtgtgatggtagatattaatactaca
gaagattatagtacactgatcattgaaaacagtaacagatatgattcaggaaagtacatt
ctctctcttgaaaacagcagtggaagccaatctattacatttaatgttaaggtccttgat
actccaggaccaccaggacccatcaaattcacagatgttacaaaaggagctttgacactc
atgtggaatgcaccagttaatgatggaggagcccacattcaaaattatattgttgagaaa
cgcgaggctagccgccgtacctggcaagaagttagtagcaaatgtacacatgaaactctt
agagttaccgaactcctagagggtatgccatactttttcagggtgcttgcagaaaatcag
tttggccgaggtgaagcttatgaaatgtcagatccagttattgccactgcagaacctgct
ccaccaaagacactgaacattgttgatacgaccaactctactgccactctggcctggttg
aaacctgaacatgatggcggaagtcgcatcacaggctatatggtagaaaccaaagtgaaa
ggctctgagaaatgggttgcaagtggtcatactaagaacttaagtatggtgcttgagggt
ctacaagagaacatggaatatgaatttcgtgtcaaggctaagaatgatgctggctatagc
aaaccacgagatgcatcttcttctgtgattattaaggaaccccacattgagccaactgct
gaccttagtggaataacgaatcagcttattacatgtaagtctggaagcactttcacagtt
gatgttcctattagtggaagaccagctccaaaggtaacttggaaacttgaggaaatgaga
ctgaaggacacagaaagagtttcaatcaagacatccaaaaacagaaccaccttgtcagtc
aaggactgcatgagaggtgatggtggaaaatattttcttatcctagaaaatatcacagga
tccaagacatttaccattacagtaaatgtcattggtagacccagtgcaccatctggacct
attcaagtttcatcaatctcatcagaatcctgtgtactcacatgggaagcaccagaagat
gatggtggaactgaaatcaccaattatattgtggagaagcgtgaatctggctcaggtgct
tggcagcttgtgaattccagtgtgaggcatacaactatcagagtcacccatctgactaaa
tatatgcattacaccttccgtgttagtgctgaaaacagatttggtgtgagcaaaccttct
gaatctgaaacaattgttgcagaacatccatttgttccttcaagtcctccaacacgacca
gatatagtttctgttactgcaaatacaatcagcatatgttgggaagaaccatataatgat
ggtggaagtaaggtgactggatattggattgagaagaaagagcgaaataccatcttgtgg
gtcagggataacaagattccatgctttgagtgctcctataaagtaactgatcttattgaa
ggccttgagtaccagttcagagtttatgcaatgaatgcagctggtcttagtaaacctagt
gaagcatcaagaagagtcgtggctcagaatccagttgatcctcccaccaaaccagaagtc
atggatgtgactggattcacggtatcaatgaaatggtctacaccactcaataatggtgga
agccaaatagtaggatatattgtagaacgcaagccgtactctcccactggtgatggtcgc
tggctgaaatgcaactacacaaatataacagacacaaacttcaccgtaacaggtctgggt
gaaggagaagtgtatgaattccatgttattgccaagaacgcaaatggaatttatagtatg
ccttcagaatcaacaggacctgtgacatgcagagctgaatattcccttcctgtagctgag
cttgacagcaaacttcttgcagacactgtgactatcagagctggatcagaccttgttctt
gatgctgcaattggtggcaaaccagaacccaaagctgtctgggcaaagggtgacaaggaa
ctggagctttgtgagaaatattccctacaatacacaaatgcacgggctatggcaattatc
aagttctgtgatagaaacgattctggaaaatatatcctgacagtgaagaatagcagtgga
gtgaaaaccattgctgttaatgtaaaagtgcttgatacacctgggccttgtcatggcaaa
attacaattgctggggtgtctgaggaaaaatgcacaatatcttggcaagaacctttagag
gatggtggagacccagtatcccactatattgttgagagacgtgacaccaatagactcaac
tgggtaacaatggaagctgagtgcaaaacgctttcatgtgtcattgccatgataaagaac
tctgaatacatcttccgtgtcaggggtgtaaacaaatatggacctggtgtaccactgcaa
tctgagcctgttgttgccaggaacacatttacaataccctcaccccctggagcacctgaa
atcattgccgttggaaaagattttgccactattcaatggttaagacctgaatctgatggt
ggtaatgaaattagcaattaccttgtggagaaacgagaaaggaaaactgccaggtggagc
agagttaacaaagacttcacaatcagagacataagctttaagattacaggtcttcgtgag
ggctgtgtttaccagttccgggttacagctgtaaatgcagcgggtgaaagtgaaccaagt
gatacatcactctctgtcttctgtagagaacctacatatacacctgattctccttcaatt
ccacgtgtggcagatacctcaaaggacaccattagccttgtttggacaaggccagtagag
gatggaggtgctgatgtgattggctatattcttgagtttcaagaagagggaacagagcag
tggggaaaagctcatgaaaaaataatcagaaacacagaatacactgtaactggccttaat
aataacaaaaagtacagttttagggttgctgcagttaatatcaatggtactggcaaattc
agcaacccctgtggagaaattgagccgttagaaagaactgaaataccggatctcgagctt
gattataacctgaagaagactgtctctttgagagctggtggctgccttcgcctttttgtg
actgtgactggaagacctttcccagtaatcagatggagcaaatctgatgtagaccttcag
aatcgagcattcattgaagtaaatgacagctgcacaactctaataatcgacaaagtaaat
cgatatgatgcagggcactatacagttgaggctgagaatccatctggaaagaaatcagct
tccatctctgtgatcatttatgattcgcctggcccaccgggtctacttaaaattatggat
ctatcaaaggactctgccttcattacatgggatgccccaagtgtggatggtggtgctcct
gtaacaaattacataattgagagacgagaggcttcaatgagagcctacaagacggttaca
tctaaatgtagcaaaacatcatataaagtcactggactgactgaaggaatgctttattac
ttcagagtcatgccagaaaatatatatggaattggtgaaccacgcgaaacttctgatgca
gtgattgtgtgtgagatgcctatggttccacaaaaacttgaagttgtggatgtaaccaag
tccactgtaaccctttcatgggagaaacctctccatgatggtggcagcagacttacagga
tatgtgattgaagcttgcagatttggaaccgagaaatggatgaaggtggcaactttaaaa
acatctgattttcagcacacaattatctctctaaatgagaatgaacaataccttttccga
ataagggctgtcaacagcagaggagttagtgagcctagagagattgtgacacctataact
gtgcaagaattgcaagttttgcccaaaatcgatctgtctggtatcactcagactgttaat
gttccggttggaaaacctattgaactccacatacctatcagcgggagacctcctcctgtt
tgttcatggtactttgagaatgtaaagatgagggcacataatcgtgtcaaaattgacacc
actaggaaatattctaaactgacagtttgtgacagtacaattgatgatacaggcgagtac
atgcttgaggtgaagaattttgtaggtactgccacagagaccattaaagttgtcattctt
gacaaacctgatatcccgaaaggcccaataaggattgaggatatcgatgccacatcggtt
actataagttgggatccacctgaaagggatggaggtgcccctatcagtggttatgtcatt
gaacagcgggatgcacatcgccctggatggctaaatgtgtctgaaactgtcagcagacca
acattcaaattcacaaggttaacagaagggggtgaatatgttttcagagtggctgcaact
aatcgctttggaactggttctttcatacaatcagatgttgtgctttgcaagagtgataaa
accattccaggtgcaccaggcagacctgaggtgtttgatgtgtctcgagatggtatgaca
atagcctggctcccaccagaggatgatggtggctttgaggtatcaggatatattattgaa
cggaaggaagtcagatctgacagatgggtgcgtgctaataaaaatccagtaacaatgaca
aaatacagatccactggcctaaccgaaggccttgaatatgaacacagggtgatggctatc
aactccagaggcactggtaaacccagtcttatttcgaaaccagcagtagcaacagatccc
attgatccaccgggatcaccacagaatccaagagtcacagacacaaccaggacatccgtt
tctctggcctggagtcctccagatgaggagggtggcctcaaggttacaggttatctaatt
gaaatgcaaaaggttggaacatatcaatggatcaaatgtaatacaacgccatcattaatt
tgtgaatacacattaacacaaatgccccaggaaggtgaattcaagttccgtgtgatggca
tgcaatgctggaggaactggtgagcctgctgaagttccaggaactgtgaaagtcacagaa
atgcaagaatctcctgattatgaccttgagatgaagcacaaagaaggctttgtggtcaga
catggtggagtaatcagattatcaattcccataaagggaaaaccaaggcccacgtgcaag
tggacaaaggatggtcaagatatttttcacagagctataatagccactagtgaagaactg
tctgaacttgtcattaaagaagcccaaagagaagacaccgggatctataaacttcatctc
gaaaacaaatgtgggaaaaaagaagcatgcatcaaagtgaaagttattggaccaccacat
cctcctgaaggaccacttaaaattgatgatattaaggctcactctattcgtgtcacttgg
aaaccccctttagaggatggtggctctgaaattcttggttatattgttgagagacaggat
gttccgaaaacagcttggtacactgtggactcaagggtggtagatacctcagttgttgtc
aaggggttgaaggaaaatgctcagtaccacatcaaagtgacagctgagaatcaatttggc
atgagtaaatgtctgaaatcagatgaagtcatcacaccaaaaacacatctttgtccccca
gaacctccaagtaacccaccagaaattttggatgtcacaaagaactcagttgcggtgtca
tggtccaggcctaaagaagatggtggctctaggattactggatactatgttgaataccga
gagatttccactgaaatgtggatgcgctatgaaactgaatttacagccactgtgtgcact
gtgactagactcatgcctgagaaagaatatcagtttcgtgtaattgccaaaaatgaaatc
ggtgaaagtgagccaggtcccacatcagaattagttttatgcaaagatccatttaacaaa
ccaagccagcctggtgaaattcaaacagtgaacgtaaccaaagactgcatttcaattcgg
tgggagcgcccaaaatgtgatggcggaaaagagatcttaggttactgggttgaatacaga
aaaactggagaaagcacttggaagaaatgtaacacggaacgatcgaaagacacaaatctc
actatgggtgggctgctggaagccacagaatatgagttcagagtgtttgctgagaatgca
acaggagtcagcagaccccagcgtacagctgtgggtataaaaacaaagccaagtgttctg
cataaaccaagtcttagaaaagaaatggaagatgccattactaagcttgggcagccatgc
atgctgaagtgccagatcattggaagacctctacctatgatcaaatggtatagatttgga
aaagaattggttcagagctgtaaatatgaaatgagctctgatgatcgtaaccattcactg
acaataacagtaaaccaacaagaagatgaaggcatatacacatgcagcgctgtcaatgaa
gcaggagaagtacagaccagtggcaagataattttggaggctgcacctcaactacaccct
gaatatcctttgaaagaaaaatattaccctgggtgtggcacaagctttcgtctacatgtt
atgtacattggacgtcctgtgccacagattacgtggttctataacaacatatctttacag
ctatctgagaatatcataattgaaaacactgagtattatactcatctaataatcaagaat
gtgcaacgcaagatcaatgcaggaagatataaagtccattttagcaatacctttggcaca
tttgaaaaagaattctacgtggaaatccaagataaaccagcaatacccgaaggacctatt
gttattgatgctttgctgaagaactctgtgatcattagctggaaagctccaatagatgat
ggtggggcaatgattacaaactacattgtggagaagcgtgaagataaagaagatgagcag
tggaatttggtttcctcttctatttttggacaatcttgtcgaattacaaaccttgttgaa
ggggctggatatttcttccgtgtttctgctcaaaaccgatatggaatcagcaacccattg
gagattcaatctgttattattataaagggtcagttagaaaaacctggaattccccaacaa
atagttgttactggagtgacaaaggactcctgtgttgtgtcttggaaaccacctataaat
gacggaggctccaaaattaaaaattactgtcttgaaaaatgtgagacaaaccagaacgaa
tggattccagtgactaatgatgaaatccatcaaactgtatactcagtgaaaaggcttaag
gaaggcttggaatataaattccgtgttaaatgtgaaaatctttggggagacagtgaatgg
agtgacgtgtctgcccctgtggctctaaaatcagatgtagaaattcgtgctcctgccttc
aaagaagacctgagaaatatgagtgttaaatacaagagtactgcaacctttgtttgtaga
atcagtggtcagcctaaacctgttgttaaatggtataagtgtggcaaagagattcagcct
gatggacagaaaattacagtgcaagagctcaaaggtggctattaccaaatggttattgct
gctgctgatgaggaggattcaactgtctatcaagttagagctacaaaccagggaggatcc
attgcagcaactgcctccctggatgttgaagtacctgctaagattcatctacccaaacat
atgcaaaacaaagaagcagtttctgcccttcgtggtgaagtggttagcatcaagattcca
tttagtggcaaacctgatccagtaatcacgtggcaaaagggacaagatctaattgataat
aatggatattaccaagtcattgtaacaaggtctttcacatcactagtattccctaatgga
gttgacaggaaggataccggtttctacattgtctgtgcaaagaacaggtttggtattgat
caacagagaattgaattagatgtagcagatgtgcctgatccaccaagaggtatcaaagtc
agtgatgtatctaaggactctgtctgtctgaattggtgtgcccctgcaaatgatggtgga
agtaaagtcacaaactatatagtggaaatgtgtgccaccacagcagagagatggatccgt
gtagcacaagcccgtgatactcattatactgtcataaatttgtttggaaaaacaagttat
caattccgagtgatagccgaaaacaaatttggccagagtgagccatctgagccaactaat
ccagttgtaactaaagaggacaaattaagagtcctaaactatgatgaggaagttagtgat
agcagagaagtctcaaagggtaaagtaccacattctgacactaaaaatgtgcataacaag
tacgtgattgctgaggagttaggacacggggagtttggcattgttcaccgttgtatagaa
accagttcacaaaagacatttatggctaaatttgtcaaagtaaagggtgcagatcaggca
ttaattaggaaagaaattacaacacttaatgtagcacaacatatgaactttttgtgtctt
catgagtcctttgagagtcctgaagagttagtcatgatttatgacttcatttcaggtgta
gacatatttgaacgcattagtatagcaaactttgaacttacagagtgggaaatagttaga
tatatcagacaagtgtgtgaggctcttgagttcttacacagtaaaaactatggtcacttt
gacatcaaaccagaaaacattgtgtttaccacaagaagtgggtataacatcaagataatt
gagattggccaagccagatatctaacccctggagataatttaaggattcagtttactaca
gcagagtattgtgcacctgaaatccatcaatgtgacatggtgagcactgttactgacatg
tggtcagtcggtgttttagtctatgtacttctgagtggacttaatccattcacagcagaa
actaatcagcaaatgattgaacatatttccaaagctgaatacagttttgatgatgaaact
tttaagtcagcaagtcttgaagcactggattttgtggaccgacttctgaccaaagaacga
aagcatcgaatgacagcaactgaagctctgagacatccttggctgaaaatgaacaaagaa
caaattggcaccaaagccataaagacaacaagacacaaacggtaccaccagatgttaata
aagaaagaatcaaatgtagttgtatcagcagcacgtgttgcttatggtggtgccattaga
agtcaaagaggagttacagttgcaaaagtcaagattgcaccatttgaacatggcccacta
gctggtcaaattaatcatcttgtagctgaagaaggagagcacgtaaaattcacgtgtcac
attgaaaactatgacagcagcacagaagttacttggtattgtggagttaggcaaattgag
gaaggggacaagtatgaaatgaaatatgaagaaggagtagctgttctgcatgttaaggat
attgccagggcagatgatggcacctatagatgcaaagttcttaatgagtatggagaagat
agtgcttacgcagagctttttgtcaaaaatgtgagatcatatcatgattttttctttaaa
cgtacagtgaaaaaattaaaacgcagggtagataccgaaagactgcttgagagaccacct
gaatttacattacctttattcaaccgcacagcatacattggtgaaaatgtgtgctttagt
gtaaccataacagtgcacccagagcctcgtgttacatggctgaaatctggccaaaagctc
ataccagaagataatgacaagaagtacagatttataagcgacaagggtcgatatcagctt
ataattcacaatgttcaacctgaggatgatgctgaatacacagttgtggcccgcaacaga
tttggtgatgacaactgtaaagcacatctgactataacagctcatccagccccggcagac
aagacaatacgcccaatgtttaaacgcttgctggcaaattcagagtgcaaggaaggacaa
aatgttcgctttgaaataagagtatcgggatcacctgttttgaaatgggagaaagatgga
ttgcctttagcatttggtccacacatggaagttattcatgaaggcctggactattatgcc
ctgcttatcggatctacacttccagaagattctggtacataccgaatcactgctacaaac
tcagccggatcagcaagttgccaagcaatactgagggtacagcgtgccacacatgtaatg
aaagaatacgagggtgcagggcagaaaatcaaacaacctgagaaaactggaatcgataaa
aaggtaaggctttcacaaattctttcaggaactgaagtttctccacttacatctgtggca
caagaagctttgagagaagcagcaattatgtataaacccacaatgccgactaagaaaatc
gtaagtgaaataactgacaaaaaggaaaaagaagaaaaatgcaagagaacagaagaaaag
agattacaaatgccttatgacattccggcacctcaaattcattcgcaaagcgctattgta
gaagacatggagatcaaacattttgtgcctttctctgacatgaaatggtacaagaaactc
cgtgatgagtacaaaatgcctgaacgaatggaaaaacatgctcagaagcgacttaaacga
attcgtctctcaagatgggatcagttctatgttgtgccacttccaagaatcaaagaccaa
tacaaatataagtggcgcattccaaagttttcacaagatgatttagaaatagtaagacca
gcaagacatcgtacactatctcctgaaatggtggcttactacaaagagagaagacgatcc
ctaagtgatctctcagatgaaaaggtcctcctacctgttcaagactatttgtcctggaag
agaactgaagaagaaagactaaggcttgaagaagaacttcagcttggtttttcagcttcc
acatcttcgttcagtcctatccactttgaattatctgcacttgctcatccggtatcaagg
gaaatgcattatgataaagaagtagtagttaaacaacatgattatcatatcccatctaaa
tatgaggctggcccaagcttaactgatctacgcctgcgccatgacacagtaacctacaaa
ccaccaagacaaaaacaaagagtgcatgaagacatggaggatcaaaaacttctttgtcca
attgccacaagtcaaagacttgcatcttaccaaagtcagttgaagtttatggaatatgag
gagaaacttagagtttctagcaaggagaaacatgctgcacatgtttcatcaaaagccaag
gaaggagaagaagcaactgaatatactgccatttcatttcctcctacagtacatgatatg
aaaagtagaatgtcattatcccctgcacacagtcaaatggtgcattccatttctgaacag
aaagcatcaccttatgcacatcctacaacaatgacaaagagtgaaaaaacacataagaca
ttgcctactcctgaaataacagtcccatatacagtttcaactgaaaacttgacctccagg
catgaaaaacttgaaagtcttgacataatggccaggtatgaagcaagaaaagcagctctg
aaatctgaaaggaaatatgaagttgtgactcagcaaccgtttagtctcgaccatgctcca
cacattactgtaagaatgcactctcatcgtgtcccttgtggtcagaatactaaattcact
ctgaatgtgcaagccaaaccaaatgcggaaatcaaatggtaccataatggacaaaagatt
caggagagcagaaaattcaaattttcaaatatcagtggagttttgtctctccaagtattt
gactgccaagctgaggatagcggtacttaccgtgttgtgtgcacaaacacaaagggagag
gctacagattatgccactttggaagtttcagaaggtggatattctatatattcatctcag
cgtaaagatgatgaccctccagtatctttagtccctgaaatgataaaaactgatgattac
caaacatcctcaataaaggcaactctgtcatctgaaacacagatgcaggtaaaagaaact
caatcaaagctggctgagaaatgtgaaagaagtatgtatgcagaacacacagcttcaaaa
aagaaaataaaagattccaaagttagtgtattagaggaggaaagtgtacaagagcagctg
aaaacaacactgccagctaaaattgtcacaaaacctcagtccttaacagtagtagagggg
cagtctgctaaatttacatgtgatgttgatggtataccaacaccaactgtgacatggata
caggaaggggaaataattgtatcatctcaacgccatcatgtgatcacaacacagtacaag
tctacttttgaaattttttctgttcagttatcagatgaaggcagctacactctggtagta
gaaaactcaggtggaaaacaggaagtgcagtttagcctgacaatttctaggtcctccccc
aaagataagataagtgcctcgccaacaaaggtgaagtcatcagaacctacagagaaatct
tcagaatcaacaggaattatacccctagaaactcacgtcatgtcacctgaagtaataaaa
ttttcaccaaaggtaaaatctcctgagccagctacctcatcccaaagggataaatcccca
gcactagcagattctccaacccctcaaaagatagaaatgccaaagacaatggatgaactt
aaggttgaggcttctggaggaaaagtaagtataacctgtgttgctgacagcaacctgaat
agagtaatatggtttaaagatgggaataaactgattcaagacagtcgtcatcattttcat
acatcatctgatggtacttgcactctaagtatccttggaattgccaagagtgatgaagga
gaatatgcttgtgaagttgttagtgaaaaaggtgtttctagagcatcattctcatttgta
ggccgagtcttcgaaagtatatattcaaaaatgaccaactttacggaacctgaaaaacaa
ggtcatgacataaagttcaatagctttccattaaagcaagatttgtcagcaggctctaca
gatgtcaaagaacttcagttacagactaaaaaagaagcttacactggttcttgcaaaaaa
cctgaaactacagaacaaattgtagaaaagatgcttcaagatgaggtccagccttgcaca
gaaatgaaaacatttcaccatcaattgtctatggctgaaggaaaatccattacccttaaa
gcaaacatccctaatgcatccactgtgagatggaccctaaatggtgaagagctgttaaat
tcaggggagtacagatatggtgtatctgggaatgaccacactttgactatcaaaaatgtc
agtcagcatgaggaaggaatcataacatgcgaagctaaaactgaagagggcattgtaaaa
tgtcagtttgacaccactgtcacttcgaaacgtgcaaatgccccttcatttctagtacaa
ccaaagtcacagaatgtcaatgaaggacaaaatgtgattttcacatgtgaaataacagga
gatcccactcctgaaattgagtggcttaagaataatgttctggtttgcttgtcatctaag
ctgaaactgagccgttctaaaaatgtttacaccctggagattaaagaagcttcaatttca
gacagtgggaaatacacagtaaaagcaaagaatatgtatggacagtgttctgccactgca
tcgttaaatgttcttgctctggttgaagaacccacaaaaatgatagttttggagaaaagt
gctacagctgccagtgtgcacgagggtttctctaccaaggcagtccatatggccacctct
atgcaggaggcctccttcagaagctccagcatggctgaggttaaaattgaaagcatgtct
gcaactagcatgtcctcaatgacatctgagtcaatggtagctatgagctccagcagtaga
atggaaatgtcaagtcattcacacatagaggggtcttctctgagaaccatcaaacacagt
catcaaggttcaccagctaaaattgaagctcttcctgaagacatctgtattgagaaagga
aaggtccttactatatcttgtgctttctctggagatcctgtgcctgagattgagtggact
cgttcagggaggacactgcccagtgcagaggacagtggcaggttccatgttgagaccgca
gaagacctcacaactcttatcatcactaatgtgaaggaaaaggatgctggagcttacacc
ctcaagctctccaatgaactaggatctgacactgcaacagtaaatatcagtattcattag

DBGET integrated database retrieval system