KEGG   Scleropages formosus (Asian bonytongue): 108924242Help
Entry
108924242         CDS       T04919                                 

Definition
(RefSeq) titin-like
  KO
K12567  titin [EC:2.7.11.1]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sfm01001]
    108924242
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sfm04131]
    108924242
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sfm04812]
    108924242
   04147 Exosome [BR:sfm04147]
    108924242
Enzymes [BR:sfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108924242
Protein kinases [BR:sfm01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   108924242
Membrane trafficking [BR:sfm04131]
 Others
  Actin-binding proteins
   Others
    108924242
Cytoskeleton proteins [BR:sfm04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     108924242
Exosome [BR:sfm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108924242
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set fn3 Ig_3 Ig_2 ig V-set Pur_ac_phosph_N fn3_2 C2-set_2 Receptor_2B4 Pkinase C1-set Pkinase_Tyr Ig_5 Izumo-Ig THB Ig_4 Titin_Z V-set_CD47
Motif
Other DBs
NCBI-GeneID: 108924242
NCBI-ProteinID: XP_029103318
Position
21
AA seq 31808 aa AA seqDB search
MTTQAPTFIQPLQSVVALEGSAATFEAQISGVPVPEVSWFRDGQVLSAAALPGIQISFSE
GRAVLMIPAVTAAHSGRFSVRATNGAGQATSTAELLVTAETAPPNFIQRLQSMTVRQGSR
VRLDVRVTGIPTPVVKFYREGAEIQSSADFQILHEGDRYSLLIAEAFPEDSGTYSVSATN
SSGRATSTAELLVQGEEEAVPAKKTKTIVSTAQIPQIRQTRVEKKIEARYEAAAATMAIR
VEEGAVAEHLRHKTPPRVPPKPTSKSPTSTLVSKVAGTRQQSPSPVRHVKAPTPTPVRSV
SPSARLSVSPIRPVKSPVMTRKQPTPSTDVLPPWKQGDYVAESSYTRMIAAAERVQTSAT
RVQMEQRWEASYGAQQQVTGVAIKEAEGGKKAEAVATVLAAVDLARIRKPAQAEGVRTEE
EIVERDLKQQALTKQTSKQQVTTVTMKTEAVQTPPPIVLAEDSVSVSQIKRSKETPIHVD
PALAPSPSPHFTVSKVTVPKHDHSYEVSIAGSAIATLQKELSSTTASQKIIRPVKPPSHK
IVETRVMSEQVLPPFRDTSERYQASFTTSMQKEIGLSFTGGMEQTHVQLEKEVVEAAAVP
SPAQEAVVPPTLVVGLKNVTVTEGESVTLECQISGHPAPSIMWFREDYRIESSIDFQITY
ENGYARLVIREAFAEDSGRFTCTATSEAGTVSTSCYLLVKVSEEIESREEIITAVSAHME
TLEEKRISTEVKEEILEVPASAEAVAPFFVRKPTVQKLVEGGSVIFECQIGGSPKPHIYW
KKAGVPLTTGYRYRVTYNKETGECKLEISMTFADDAGEYSICARNQLGEVSASASLLEEE
EYEAYMKMHEMTIMTEGIIMVQEPRVADVPPVVMTEYEREQILMQKRMTQQTQMLKTFVT
EQEFQISAFEERIIREIELRILKITYQVLVTEDGEEMVMSVAEHEAVEPVFDTPVKNYRI
LEGMGVTFHCKVSGNPLPKIAWYKDGKRIIHGGRYQMEVLQDGRASLRIPVLLPEDEGVY
TAFATNMKANAVSSGKLYVEPTTVVGAQPYFPQPEAIRRISSTSPRSLSRSPGRSPGRSP
ARRLDETDESQLERLYKPVFVVKPSSFKCSEGQTARFDLKVVGRPMPETFWFHNGQQIVN
DYTHKIVVKEDGTQSLIVVPALPHDSGEWTVVAQNRAGKASVSMTLTVDAKENLVRPQFI
EKLKNISVKEGTLVELAVKAIGNPLPDIVWLKNSDIISPQKHPHIRIEGTKGAANFKIAS
TTGSDSAWYTATAINKAGRDTTRCRVNVEVEFAEPEPERKLIIPKGTYKAKEIAAPELEP
LHLRYGQEQWEEGDLYDKEKQQKPHFKKKLTSVRLKRFGPVHFECRLTPIGDPTMVVEWL
HDGKPLEAANRLRMINEFGYCSLDYEVAYARDSGVVTCRATNKYGVDQTSATLIVKDEKG
LVEETQLPEGRKGMQRIEEMERLAHEGALAGVTAEEISEKTKPEIVLVPEPAQVLEGETA
RFRCRVTGYPTPKVNWYLNGQLIRKSKRFRLRYDGIYYLEITDSKSYDSGEIKVVAENPE
GVSEHCVKLEIQQREDFRSILRRAPELKAPESGTSPDRGRVSFEVQKVDKPVDTTQPKEI
IKLRKAERVVHEKSTEETEELRSKFKRRTEEGYYEAITAVEFKSRKRDDSYEELLKKTKE
ELLHWTKDVPEEEKKKEEERGKVTIPKIKPERVELSPSMEAPKIMERIQSQTVSQTDEVR
FRVRVVGKPDPECQWFKNGVLLEKSDRIYWYWPEDNVCELVIRDVSAEDSASIMVKAINI
AGEASSHAFLLVQAKQAVVFTQELEDIIAKEKDTMVTFECETSEPFVKVKWLKNNMEIFS
GDKYRMHSDRKVHFLSVLMIEMKDIAEYTCCVVEDDHIRTTAKLTVEGAPLDILTALENI
EVPETYSGEFECEVSREDAEGTWYFEGKEITPSSKYVMSSRRGRHSLCVRDVKKEDQGKY
SFVVGDLKTAASLTMKLRPVTLMQGLSDLSVCEGDIVQLEVKFSQENVEGIWMRSGQAIL
ATDRIHIVIDKLVHKLLIEDAQRSDAGMYSFFVPAQDITSSAKLTVQSIGILTPLKDVTS
VEGTKAVLEAKISAADISSVKWYHNDKLIVPSERVQFVAKGSKQRLVFSRTFASDEGCYK
LVVGKAETSCNLTIEKIEILKQMEDQMCTETQNVTFEVDLSHSGIDAVWTFKNQTLKAGA
KYKMEAKGKRYTLTVINTMKDEEGLYTFAAGEKTTSARLSVTGGAVKRPLQDVTVAESQT
AELECEVANPTAEGKWLKDGHPVEFSDNIRSEEFGAVRKLVIIITRPQDIGEYTYQVANS
TTTGNLKVEAVKVKKTLKNQTVTETQETVFSLELTHENVKGSQWIKNGVEIRPSDKYEIR
VDGMVHSLKIKNCTTQDESVYGFKLGRLSANARLNVETIKIVKKPKDVTSLEDSTASFEL
SLSHDNIPVTWMFNSVELKPSENCKILSERKAHKLIIQNVNKHNAGEYTAIIGHLQCSAT
LYVESLRITKTMKNIEVPETQVASFECEVSHFNVPSTWLKNGVEIEMSEKFRIVVQGKLH
QLKIMNTSREDSAEYTFICGNDKVSATLTVNPILITSMLKDLNAQERDTITFEVNVNYEG
ITYKWLKNGVEIRSTERCQIRSKQLTHSLTIRNVHFGDVGEYQFVAGSAATSANLYVDAR
VIQITKHIKDIKVIEKKKAVFECEVSEPNIQVTWMKDGQELELSDRYKVSTEKYLHRLLI
QTVRLSDAGEYCVVAGSSTSKAQLTVEGRDVRITDLVEKEITVVEKQRATFEFEVNEDEI
EGRWLRNGIEINFSVEERFNYVAIRKIHRLTISETYRSDAGEYTFIAGRNRSMVTLHVNI
PEPPQIIQHMKPQSVEAGKPARFSVVVTGVPQPQVFWYKNSQILSSGFKCKFLQDGNEYT
LLLVEAFPEDAAVYSCEAKNESGEATSSAALNVEVPEVISPDTGTPLSPPVVLSPIYNTS
VKEGESARFQCRVSGEDLNIFWYSKDKEIKQSNIFRMSQFDDNCQLEIARVYSDDAGEYT
CVARNPAGMVSCAAFLTVDVIKVEEEMEAKIEEEIKVAPVFKHKIQPLEVSVGNRAKFEC
EIEEAPNVKFKWYKAGIEVRESEKCKIFSHHLTTSMELLNLTKADTGEYTCKATNQHGSD
SCSAFLNVSEVFPPVFTTKPEPMTLYVGKQASIQCVVTGSTPLSVVWQKDNVSISSGENY
RASVDKNRYTLEIVKLQVADQGTYICKASNIVGTDMCCTELSVIDKPSFVKTLTPMTVAV
GNPLRLECQVDEDTGVGITWTRDGRKLHNSMDLKLTFEDKIAALEIPHAKLKDTGTYTCT
AANDAGSSSCSSTITVQEPPTFLKRLEPKILWKQGATARMQCTVKGSPELHVTWFMNDKE
LTTGEKHKITFKDGQATLEMSHLTVADSGHYTCEVLNEAGCESCSSSVTVKEPPSFKKEL
QTVEVVKGTTALFECEVSGTAPFEVSWYKNKKPISSDKKYKIVCQDNIATLEVNSFESAD
IGDYQCVVSNDVGKISCKSTGRLKEPPSFFKKIENTSAILGNSVRLQGSLKGSAPITVKW
LKDSEILSAEDDANVTMTFENNVAVLAIKTVNVTHSGKYTCQAENEAGKQQCEATLSVEE
PAQIVDKTPSVSVTAGEPVTLECTVSGSPELKVKWFRDGKEMTASRKYKMMFKDNVAVLK
ILAAEKGDSCEYTVEVANRVGKDQCSCSVTVLDRIIPPSFTKNLKKIDGNIGMNVSMECK
VSGSQPITISWYKDEKEIKASAKYQMDFKENTAALGIFQLEKSDAGLYTCRATNTAGYKE
TSGTMSVKEPPAFIIKPDSQDVIPGSTVILKSAFTGTPPFTIKWFKGDEEMSTGGTCFVK
KDASSTFMELHSVKPTDSDNYTCQVANDAGKVTCTAILFVKEPPKFVMKLESSKLVKSGS
TIILECKVTGSPTIKIKWFKNETEITSDDKYQMTFSNSVATLQIVKSAVDDSGHYICEAS
SEAGCDRCNCVVTVKEPPTFLKAFESKEVVKGSDVVLEGNISGSSPFEVTWYRDNKIIRN
DKKHKINIFEDAVALQILKCEVGDVGNYQCIVTNEVGESSCDCQVALKEPPSFVQKIENI
NSVVGSEITMQCSLKGSLPIAILWLKDDRELKEDENIKFFYEDQTVQLHITNIQLKHEGK
YICQAKNEAGSQKCSASLIVKEPAHITEKAKSISVTAGDPATLECRFSGTKVLKARWLKD
GKELTTGQKYKVHHTDKNSMLKILSADKRDGGEYIFEISNDVGSSTCEATVTVLDQIIKP
SFTRKLKSVDSIKGSFAHLECLISGSLPINVCWYKDNKEITADDKHKCTFFENTAFLEIS
RLDSSDSGSYTCIAKNEAGSDQCSGTLFVKEPPIILEKPNSADVLPGSRVQFSVLFSGTP
PLTIKWFKDSKEILSSSQCAIQKDNTSSLLELFFTKTSDSGEYSCEICNDVGSEFCQAAL
FVKEPPKFTKKPERITVTKIGQTVRFECQVVGTPEIDIYWFKDGNEISPSDKFKMSYENS
LVSLEILCTETKDSGVYYCEARNEAGSESCSMELKVKEPPAFVQELTPLEVVNGSDASFK
CQVTGTPPFEVSWQKDAKEITPDKRHIVLQSNGFVSFAILKCEALDVGDYQCTVANEVGK
CSCAAALRTKEPPSFVKKIQNVAVFLGKTAEFQCVVAGSPPLTVQWQKDEDWLVEDANIE
QKFEDNTASLRIMACEASHSGRYTCQVTNEAGLVKSFATLVVQEPPQITEKPEMINVTAG
DPVSFECKVSGTPELKVRWLKDGKELTSSRHYKLSFENNISSFKIQSAQTGDGGDYMFEV
ANAFGVCHCKVTLVVLEQIIAPSFLKPLREMHEVLGSFVKIQCTFSGSLPISVEWQKDGN
IISAGTKYKLLQEDNYVSLDIEHLEKADGGEYVCKLTNKAGTCECRGSLIVKEPPGFALK
LEPQAVLPNSTVRFKSTLKGTPPFTVKWFKEETELITGPSCFTGLEGSSCFLDLYTVGVP
QSGIYTCQVSNDAGTARCTAELLVKEPPEFVLKLPPTKFVKQYEALRLECKVIGTPLIRI
LWYKNENVIAEGGNYKMSFVDSVAVLEIPISRFEDDGIYTCEAQNDAGSISCSTTLIVKD
PPSFIKVPTSVEGTRGRDASLDCELKGTPPFEITWYKDKKPVKESRKYKFVLEGCSVTLH
ILSLDASDVGEYQCRALNNVGSDTCSSTVKLREPPVFVKKLSNLSVISGEEATFIATVKG
SQPMTVSWVQDKDHVLRDGDNRKITFEDNQTTLRIFKADETCAGKYTCQVKNDSGVVESV
AKLTVLEPASIVDRPESFSVTAGDTAALEVTVAGTPELKPKWFKDGVELSSGKKYKITFS
KMVSTLKVLSVESLDSGEYTFEIKNEVGCDLCKISLTVLDKIIPPTFIRKLKDSHLIVGK
PGQMDCKVSGSPPFIISWYHDGEEITSGPNHEVAFCDNTCTLNMPILKLSDSGVYTCKAV
NTAGASETSATLYVKEPPSFVERPQPLEALPGTDVTFSAIVKGSAPLKLKWFRGSKEIIS
GQGCEIALQGNIATLKLFKIDKSHAGEYTCQVINDAGKENCPVSLFVKEPAHFVKKLKDL
AVEIGKLLFLECTYAGSPEIQVKWFKDGHELYSSYKYNITTTESSCILECLNCDKDDSGK
YSCEVSNGAGSDSCHTQVSILEPPYFIENLEPMDVTVGDAVCLKCQIGGTPEIKVSWFKA
DGKVRSSAACKMEFSRGIACLKLSKVCKSDIGEYTCKAENRIGSASSSCRLTVQEAKTPP
SFPKKIMSLQQTEGQPVRFECRVAGSSPMEVSWLKDGESLQHGDEYSMSFDDNSAVLTIS
RGEMRHSGEYTCVATNSVGTASCRAKLTLQEPRYPPVFDKKLQPVEVLVGDSVDLECHMT
GSLPIKVTWSKDHKDIRAAGNYKISCLENSPHLTILKADKADSGQYSCHASNDIGKDSCT
TQVSVKERKIPPSFTKKPSEVMVDVEGKVVKLEGRVAGSQPMSISWFRDNCEIYSSDNVE
ISFRSNVAVLSIKKAQLSDSGTYTCQASNEAGSASYQVSLSITEQKMPPMFDRPLKAVSV
NEGESLHLSCQVRGSPPLTIQWMKDRKEITSSANMRITFVEGTATLEISATSKSDGGDYL
CKVTNDAGSEFSKSRVTIKEKAGVAPAAAEAMPALAKPVKKLENLFFVDEPKSVKVTEKG
TATFFAKVGGDPIPSVKWMKGKWRQITHGGRITVEQKGQDCKLEIREVTRTDSGQYRCVA
LNKHGEIECSTDLKVEEKKGATLLEGDLRAKLKKTPSKQKSPKEAQEIDIVALLRNVDPK
EYEKYARMYGITDFRGLLQAIEFIKKEKEHETGRVEVERRERESDEDLAKLMSDLQRRME
QAEPITLVKDITDQTTSKDNEAVFECEIKINYPEISLSWYKGTQKLDTNEKYEIRVVGDR
HILKIKNCQSEDQGNYRVVCGPHISGAKLTVREREVEEDIKPVSAAKIHFTKSIQNIVVN
ERQSATFECEVSFDNAIVTWYKATWELKESPKYSFRSEGRRHFMIIHNVTAEDEGMYSVI
VRLEPTGEAKSTAELYLYSKEVDVERAGFDIPDSSVDVPEVSSEVTSKVDTSTVYYEEKI
EMREFESWTIQEERVIQEISTIQAKMPVDETVPRAEIGMRDKEPVKVPEPYIKPDLGAPT
VTEAPTPTQVPEARIPVQEDIPAVVIPEQRYHPMPKEYEEVKKPVPEAAPIPSKIDKDQI
TSKKDIPEPAFVAPEPKLHVTRESEAAAVAAAKVEPEPKPPPAKKAEEPPSRVPDEVKRP
EPGKPEQLKPKPEPTTIVSKEAAPEKVPEAPKKPEAAAITPISIPKKEEEPKDVPPQKKE
VTPEKVPVKAKTPEIPKEEAARKPDLETCPPKGIIPLEGMDSGPLWKNSYFIDCQYLNFF
MCAFFLQFFIKICLVSSLLHSLFHTCPKENPIFSVQVAVKEKEAPAEKVLPVVPKKELEV
TLTRGRPEAISAFPAWNIHLSDIFGFHYLCLLFIVLIFPVMCVLCLKLQILSRPFFLFEL
NVSYFNSLSFQKYLLKPGTLVAISKKPEQVPSAVIEKLEEVSYGIEVTSQTEEFHLQEEV
YESMEGFSKEKEKLSFEDVSHVSRDEIALKREEIPKPKVFLQKTEEAPKEVLPSKKGDTI
SAEAVTPQQALDVPKDKQAAMSEIRKMQEVSFVKEEASFEDAISFQKEMYESTELNYKDQ
ELKSTMDDSQKVQQAPFFEYQKMHKALFLKDEPSPEVGIAVKKEVYETTKFSCEEKELKS
TASVADSGERYLKSDKARTMKVSKKFKQTPVSETEERREVSFDKEQASPVATVPLKTDVC
ESTELSYKEKEVKSRDDYTDLRESSLKIEDIPESMATPEMADKVVRKMLPSEDEEVVSLK
AGTAPFQAMKVSKKPKQAPVSEIQERQAVSFDKEQASPVATVPLAKDILDSTELSYKEKE
MKSRDDYTDLRESSLKIEDIPESMATPEMADKVVRKKLPSEDEEVVSLKAGITPFQAMKV
SKKPKQAPVSEIQERQAVSFDKEQASPVATVPLAKDILDSTELSYKEKEMKSRDDYTDLR
ESSLKIEDIPESMATPEMADKVVRKKLPSEDEEVVSLKAGITPFQAMKVSKKFKQTPVSE
TEERREVSFDKEQASPVATVPLKTDVCESTELSYKEKEVKSRDDYTDLRESSLKIEDIPE
SMATPDMADKVVRKMLPSEDEEVVSLKAGTAPFQAMKVSKKPKQAPVSEIQERQAVSFDK
EQASPVATVPLAKDILDSTELSYKEKEMKSRDDYTDLRESSLKIEDIPESMATPEMADKV
VRKKLPSEDEEVVSLKAGITPFQAMKVSKKPKQAPVSEIQERQAVSFDKVQASPVATVPL
AKDILDSTELSYKEKEVKSRDDYTDLRESSLKIEDIPESMATPEMADKVVRKMLPSEDEE
VVSLKAGTAPFQATKVSKKPKQAPVSEIQERQAVSFDKEQASPVATVPLAKDILDSTELS
YKEKEMKSRDDYTDLRESSLKIEDIPESMAPYQKIDKVVRKKLPSEDEEVVSLKAGTAPF
QAMKVSKKFKQTPVSETEERREVSFDKEQASPVATVPLKTDVCESTELSYKEKEVKSRDD
YTDLRESSLKIEDIPESMATPDMADKVVRKMLPSEDEEVVSLKAGTAPFQAMKVSKKPKQ
APVSEIQERQAVSFDKEQASPVATVPLAKDILDSTELSYKEKEMKSRDDYTDLRESSLKI
EDIPESMATPEMADKVVRKKLPSEDEEVVSLKAGITPFQAMKVSKKPKQAPVSEIQERQA
VSFDKVQASPVATVPLAKDILDSTELSYKEKEVKSRDDYTDLRESSLKIEDIPESMATPE
MADKVVRKMLPSEDEEVVSLKAGTAPFQAMKVSKKFKQTPVSETEERRAVSFDKEQASPV
ATVPLKTDVCESTELSYKEKEVKSRDDYTDLRESSLKIEDIPESMATPEMADKVVRKMLP
SEDEEVVSLKAGTAPFQAMKVSKKFKQTPVSETEERREVSFDKEQASPVATVPLAKDILD
STELSYKEKEVKSRDDYTDLRESSLKIEDIPESMATPDMADKVVRKMLPSEDEEVVSLKA
GTAPFQAMKVSKKPKQAPVSEIQERQAVSFDKEQASPVATVPLAKDILDSTELSYKEKEM
KSRDDYTDLRESSLKIEDIPESMATPEMADKVVRKKLPSEDEEVVSLKAGITPFQAMKVS
KKPKQAPVSEIQERQAVSFDKVQASPVATVPLAKDILDSTELSYKEKEVKSRDDYTDLRE
SSLKIEDIPESMATPEMADKVVRKMLPSEDEEVVSLKAGTAPFQAMKVSKKFKQTPVSET
EERREVSFDKEQASPVATVPLAKDILDSTELSYKEKEVKSRDDYTDLRESSLKIEDIPES
LAPYQEIDKVVRKMLPSEDEEVVSLKAGIARFQAVDIPKKAERASLFDVQTMQEVSLVKK
ETFGEAISFQQDVYECTELSSKGKKQRSGEEFAASRERTLERTKPEKKTVTPTPFAEVFP
PEAEKKVVPEGPKPAPAQPPEKVPQPEEPEKKTTPDVIPLSVKEIVPPEGDAMEPVTAPG
AAKKAFIASDKERETRPILKQKSKIPVEEETFEMPVLKKMSRRLKGKDEEKETVKLKKIP
KAPTDEMPGEPEITLQEVLSYEKEELIHSEAITEATFTESHEVFRGGEKEVIEQVQLMKP
KKFPTEAVFTDEKEVGLKEAVIIPKEESPKETSLTLKKVLRIPTKEKEQEKVVLKPIERP
AKPEEVLMKEVKKEVEREPLAFKKIERPQKDEAVKEPAVPREKVEISLDEKEEEPSVRQA
ADKTPKDKKPQEPSKQLTRVKRVPTHEQEGEKVELKPFSKVPKPELPVQKIPSVSKEKED
TSVMKPVKAAKDEKPVDMITAPKKAELPATLDKEPQKFTKTESPHEQEMKPVTPKEIPLR
EKLSPKEDRKPVPLKKEILPKEPDEKEILLKHVEKPKQDVQLKKTPSPKVTLSKLKEPEL
SPVERKPSLDAIKKLPPKISPKDSIESITLKKVPKKPSPPEEKTVEGAPLKIGKGKVPVM
KEMSPETVQLKKIPTQQEEEIYKEGPEREVEGEESSLEWELTPRESYGSSEDWEETASEE
GALETPGMKGDRREGKPKEEPGKGRGIRAKQTPSPADSDKRKGLKPGTGGEKPPGDAPFG
FQLKAVPLKFVKELKDIVLQEAESIGSSAVFECQISPSTAITSWMKDGSNLRESPKYKFT
SDGKDRKLAIIDVQLSDTGEYTCVAKLGNKEKTSTAKLIVEELPVRFTKNLEEEISVIKG
QPMYLTCELSKERDVVWKKNGIPIQPIPGKLAINVIGLQHAVTIQNSEDDDAGVYSCECE
NIKTQGNVKIVEIIRDWLVKPLRDQHVKPKATATFKGELFKDTPNWKWFKGDEEIPIEPT
DKTEVKKDGNILTLVIKNATPDDVGEYSMEVEGQRYSAKLTLGEREAQILKPLSSVEVYE
KETANFETEISEEDIPGEWKLKGQILTRSPTCDIKAEGPKRFLTLKNLEVEQSGEISYQA
LNAITTAMLTVKEIEMDFTVPLKDVSVPEKKQAQFECTITRDVPKVMWMKGTDIITKGRK
YDIIDDGKKHILVINECEFDDEDQYTIEVQGKRSTAKLTVEGIRLKVTTPLNDQIVKEGK
TARFELELSHENVPVTWYKNETKLHPSRTVLTHVDGKKHILEIKEVTLDDTCQIKAEAKG
IPTMANLTVIEADPYFTVKLQDYTAVEKDEVILDCELSKDVPVKWYHNEAEVKASKMVSM
KADGKRRILSIKRVDNKDKGTYVCDCGTDKTVAEINIEARDIKVIRPLYGVELFDGETAR
FEVEISEDDVHGQWKLKGEVLTPSPDVEIIQDGAKHILTLYNCKIPQSGEVAFQAANAKC
AANLKVKELPLTFITPLSDVHVYEKDEARFECEVSREAKTFRWLKGSQDLKTDEKFEILQ
EGSRHILVVKSAAYEDEAKYMFEAEDKRTSGKLVIQGIRLEFIKPIKDVTVKERETAEFS
VELSHDKVPVTWYKNDVRLHPSKVVHMSEDGKVHTLAFKEVSIDDTSLIKAEALGKSSEA
MLTVLEGEPYFVRKLQDYTAVEKDEVVLMCELSKPSAEVKWFKDGKEITPSKNVFMKSDG
KKRILTVKKAEKGNIGEYTCDCGSDKTAAKLNIEERDIKIIRPLYSVEVTETESARFETE
ISEEDVHGHWKLKGDALHQSPDCEIKEEGTKHILILYNVLMSQAGGVDFQAANAKSSAQL
RVKARVIGLLRPLKDVTVTAGETATFECELSYEGIVVDWYLGNTKLEPSDRIVTRAEGRV
HTLTVRDVKLNEAGEVKLTAKDFLTQARLIVNEPPVEFTKPLEDQTVEEEATATLECEVS
REKAEVKWFRDGQEIRKTKKYDIVADGRKRKLIIQGCTLDDSKTYTCDAKDFKTSAFLNV
EPLRVEFTKPLHDVEVKEKDSARFECEVSRENAKVQWFKDGSEIRKGKKYDIIAKGVQRI
LIINKSVFEDEAEYECDARTAKTSGMLTVIEEEAVFTKNLSNVEGTETDSIKMICEVSKP
SAEVRWFKGDQELPEGGRFEQIQDGRKRILIIRDLRMDDVGEYNCRLPSSQTSATLRINE
KAAEFITRPQSQEVVEGEKAEFVCSVSKDTYEVKWIKDDKELEIGDKYDIVCDGKRRALI
VKDCLLKDEGPYVALIGSSRATADLFVIEKLRIITPIKDTQAKEGQEIVFNCEVNTEGAK
AKWLKNDETMFETGRFVMTQKDNVFSLRIKDAQMSDEANYTVTLTNHRGEHAKSSATLSI
QEEDLRIIEPLEDCETLEKRTVTFSCKVNKPNVTVKWMKGGQEITFDKRILYKVDKNKHT
LTIKDCSLADEAEYSVVAGSDKSTAELIISEAPTDFLTQLMDQTITEFEDAEFSCQISKE
RSEVKWYKNGREIREGPRYRFEKEGNTCRLHIKECRPDDECEYACGVDDRRSRARLFVEE
IPVEIIKPPRDIFDPPGSDVVFEAELNKDRVEVKWLRNNMTVVQGDKYQMMSEGKVHRLQ
VCEIRPRDQGEYRIIAKDKDATAKLELAAVPKFKTTDQNLVTDAGKPFVMTVPYDAYPHA
EAEWFFNDVSLPRKNFDTSADQTEYRLKDPKKSDQGRYKIVIQNKHGKAEAFINLEVIDV
PGPVKNLSVVDTADGEVSLAWDEPEIDGGSKIIAYVVERRDVKRKTWTMATDHAEGTEYC
VTGLHRDSMYFFRVCARNRVGSGPNVETDKPVQAKNKFDVPEAPQNVMVGNVNKFGATLS
WEPPEYDGGSEITAYIIELRDRTSVRWEPALVTKPEDRTVVINDVVEDKEYIFRVRAENK
AGIGKPSVATDPVKIMDPIERPSPPLNFDYSDQTKISVLLTWDTPLSNGGSPITGYIIEK
CEDGTDKWLRCNARLCQDLCYKVTGLKHEQKYHYRVSAENAAGVSDPAEQIGPLTADDLH
VAPTMDLSAFRDGLEVIVPHPLTIRIPITGYPLPTAHWSVADKDLVAGDRVSMVTKNTFT
ELVITPSVRPDKGIYTIHLENDVSTVSGEIDVNIIACPSAPRDFKVAEVTRHHVHLMWEA
PEHDGGSPLTGYQIEKREASRKTWVKVISGIQDQEYTITDVIEGKEYLFRVIACNKCGPG
EPAYIEEPVNVSSPATVPDPPENLKWRDKSANGIFLSWEPPKYDGGSVIKGYIVDKCQRG
TDKWEPCGDPVPELKLQVTGLTEGQWYAYRVRALNRLGASKPCRATDEILAVDPKEPPEI
MLDVKLLAGLTAKAGTKIELPADVLGKPEPKVTWTKADLVLKADDRVSIETKPGHSTVSI
AKTKRDDTGTYIIEAVNSSGRATATVDVNILDKPGPPAAFDISDITNESCFLAWNLPRDD
GGSKVTNYIVERKATDSQVWHKLSSTVKQTTFKATNLVALKEYVFRVFAENQYGIGPPAE
HVPIVAKYSFDPPGAPTKLQASDIAKDSLTLTWNEPEEDGGSPISGYWIERHDPDNDRWI
RCNKLPITDTTFRVKGLPTKKKYKFRVIAENLAGPGKPSKETDPVLVKDPIDPPWPPGKP
KVKDVAKTSAFLQWTKPEHDGGAKIESYSIELLKSGTEDWVRVADGVPMLEHFLKGLMEK
QEYSFRVRAVNSAGESEPSDPSDPVLCKERLNPPSPPRWLSVVSVTKSNAELKWTAPERD
GGSPITNYIVEKRDVRRKGWQAVDTTVKETKYTVTPLNEGSLYVFRVAAENAVGQSDFCE
LEDSVLAKDTFTTPGPPYALNVVEITKTHVDLKWEAPKNDGGRPITRYVIEKKEKLGTRW
VKSAKTSGPDCQYRVTDVIEGTEVQFQVRAENEAGVGHPSEPTDIITIEDPTSPPSPPLE
LHITDASRDQISIAWKPPENNGGSPIIGYHIELCEAGTEKWMRVNSRPVKELKYKAEEGT
IPEKEYIFRVRAVNSVGVSEPSDISENVFAKDSDCNPTLEVQTQDIVVVEGEKLQLPIPF
RAVPQPKVSWHKDGKELKADERLTFSSEYTFANLEITSCLHNDAGVYTITLENKLGSTTG
TIHLKVIGLPGPCKDIVASDVTKNSCKVSWEPPDSDGGSPILHYVLQRREAGRRTYVAVM
SGENKLSWPVKDLIPNGEYYFRVKAVNKIGGGEYVEIRNPVIAEDQKQRPDPPVDVETHN
PTSNSLTLTWKPPMYDGGCKIMGYILEKAIKGEEKFERCNDFLVPVLSYTVKGLKEGKEY
QFRVRAENAAGVSDPSRSTPLIKAADAVDPPKVFLSGNLQSGLTVKRGEEIRLDAYISGS
PYPTVTCRKGESRAVVRDSIRSDHGVFMIRVENDHGIASATCEVNVLDVPGPPVNLVFEE
IRNTSVICKWDPPVDDGGSEILNYILEIKDNSKAEIGWITVTSTLRRCTYHVTKLIEGKQ
YLFRITAENRFGPGAPCVSTPVVAKNPFDPPEAPEKPEIEDITANSMLVTWTEPKDNGSP
IVGYWVERREINSTHWARVNRNLINALEVNVEGLLEGLTYIFRVCAENAAGPGKFSIPSD
PKTAQEPILPPGPPIPRIVDTSSCSIGVAWDPPKYNGGGDILGYHVDKVLAGTNDWSRCT
ERPWKSCEFTVYGVREGAKYAVRVIAVNAAGEGPPGITEPVTVKDPQELPVVELDLSVKN
GVTIRAGETLTVPAHVTGRPPPYVKWTKDDSAPNKERVVTESVGNDHVLTVKNITRKDEG
KYQIIASNSSGTKSAWTRVEVFDVPGPVLDLKPVVVTRKLMMLNWSDPEDDGGSDLTGFI
VERKDSKMHTWRQPIETIPSKCEIVGILEGQEYTFRIVAKNKYGCGPAVELGPILAVDPK
GPPTSPERFHYIERTKSSITLTWRPPRNDGGSPILGYFVEKKRQNEAAFVVANKDICTDH
TLTVENLSELHMYEFRVKAVNEIGESDPSIPLTVVIQDDEVAPIVTLLKHFKGDEIIVKK
GEAIEIPAEVTGLPMPKIEWLKNEIVISKSTKTLIIETAEVHRTKSDTKLTIPETIRQDK
GCYTLTASNRLGSASHSITVEVLDRPLPPRNIVISNIKAESCYLNWNAPEDDGGSELTNY
IVEKKDTRSEKAEWEEVNNAVIDRRYGVWNLETNGTYKFRIKAQNRYGISDSCESEEVVI
KDPFGLPGPPGKPVIVDHNKDAMLVTWEPPLDNGGSTITGYWIEKREKGASYWARVSRAA
VTKRGLKGWEFSVPRLIEGAEYQFRVMACNAAGVGPPSDPSDPALAIEPLYPPGMPSTPE
VTGKTKNSVTLSWNPPEKDGGSPIKGYIIELQGEGTSEWTRVNEPDALHPTTEFTVPNLP
ELKRYRFRVIAVNAVGESEPSPSTAEVLVKELQVEPKIFVDVNSLELLSCRAGTTIRIPA
VIEGRPTPKVTWEFEGGAKTETKDRLHVLPVDSEIQSTDTTSTITINDCKRNHSGRYTIT
AKNKAGQKVVNVRVNVLDVPGPPKELKVADITRNTCRLTWKLPDNDGGERIKSYFIEKKA
VGSHAWTKVNPACASQAFVVPDLLEGEEYLFRVRAENRFGMGPHAETTEPVKARDPIYPP
DPPTRVKINLVTKNTVTLTWAPPKNNGGAPVKHYIIERLSWDTSGAEKETWKQCNKRDVE
ETTFQVEDLKEGGEYEFRVKAVNEAGASRPSATAGPIVVKDQTCAPTIDLKELMEGEEGT
DISIVAKIKGCPFPTLTWQKAPINKPDDKAEVQYDQHVNKLVSDDRCTLLIKQSKRDDTG
LYKITASNTFGKASKEIRLSVLGCPGPPVGPVKFEEIFAERVTLSWLPPKDDGGSKITNY
VIEKREDNRKTWVHVSSDPKECVYTVQRLTEGHEYEFRIMAQNKYGVGPPLNSEHEKARN
LFTVPGQCDKPTITDVTSDSMTVNWEEPEYDGGSMVTGYWLERKETTSKRWTRVNRDPIK
IMPLGVSYTATGLIEGSLYQFRVIAINAAGCGLPSLPSDPVCARDPITPPGPPTPKVTDW
SKSTVDVEWIPPLNDGGSKITGYIIEYKEEGKEEWKKAKDKEVRGTKFVVSGLKELGLYR
FRVRAINAAGVGEPGVVSEVIEVKDRTIAPEIDLDATVKEKIVVHAGGVIRIIAYVSGKP
PPQITWNRDDSALPEEAVIETTAISSALVIKNCKRKHQGIYTLIVKNEGGERRKAIIVEV
LDVPGPVRTPFVGENLTNDSCKLTWYSPEDDGGSAITNYIIEKREADRRGWTAVSYTVTR
HSAVVQGLHEGKAYFFRIAAENIIGMGPFIETTAQVLIKDPISVPERPEDLKVTSVKKDS
ISVTWRPPKYDGGSEITMYILEARLMGKDSFTRLSNEKLMDRKYTYEGLKEGDSYEFRVS
AVNEIGQGKPSFCTKPVTCKAELEPPTIDLDFRDKVLVRVGETCTLQGRYTGKPTPTVVW
CKDDEELKEDDHILFRNTSSTLCLNIINAKREYSGRYSVVVENSNGSCKGICNVIVVDRP
QPPVGPVVFEEVFRNYMVISWKPPLDDGGSAISNYIVEKRDSNRDLWMPVTSTCTRTTCK
VPKLIEGREYIIRICAQNMYGISDPLLSQEMKAKDIYKVPEAPKQPVVKEVYKDSALLTW
EQPRDGGKPITNYIVEKKETMSNRWSRAVKDRIYPETEYWVPDLLKGCEYEFRVMAENEI
GVGDPSPPSKPVFARDPVVIPGPPVLLEAVDKTKNSVTLSWQPPHYDGRGKILGYLIEYQ
KAGQEEWIKANQTPDSCQETKFKVISLADGELYRFRVMAVNSAGVSEPAYVPEPVRAQDR
LEPPELLLDANMTREVRAMAGTHIVLRAGIKGMPFPKVTWKKNDADVPPRADIKVTGVGT
KLEMRYCVRSDSGDYTLTVENPAGSKTATCTVLVLDKPGPPHSLKISDVRSDSAYLSWKD
PEDNGGARITNFVVEKKDIASAQWVPVCSSSKKRSITVKHLMEGTQYMFRVAAENQFGRS
EYVGTTKPIKAMNPLFPPGPPKNLHHVDADKTEVWLQWNWPDRTGGSDITGFLVEYQEEG
EKDWITFKTVSIPESHVTGLQEGKTYRFRVKAENAVGLSRPDTTVPVLCQEKLVPPIVEV
DVKLIEGIIVKAGSTIRLPAIMRGIPIPTAKWVIDGTEIKSEGKVKIDTDNYSTVLSIND
CTRNDSGVYLLTVSNAAGSKTVALNVTVLDVPAPPIGPVKILEVAPEYMIIEWRPPKDDG
GSPVMNYIVEKRESSKETWGGVSSGSTSTKVKIPRLQKGSEYIIRIRAENKIGIGAPLES
APTVAQHMFEPPGHPGKPNVSEVTENAVTVGWTMPLFDGGSPISGYIIERRHQAGKWIRV
NKTPVQDLRYRVLGLFEGNNYEFRVFAENIAGFSGPSPVSDPVKPSRPVTVPGPPVNPKL
KDWSKSYADLVWTKPTRDGGSPILGYIVEYQKSGSTEWERINKDDLIKQCAFRVPGLTEG
SEYRFRIRASNMIGDGEPRELPESVVAKDILVPPEIDITSHDRLTVRVGHNINLVAYVKA
RPDPEITWIKDQKVIEKDKRTAINLNFPLVHMFIKEATRADHGKYIIKATNDSGEAQATI
TVNVLDRPGHCQGLKVTYVTKDSCMISWENPEDNGGTEITNYIIECREPSQRAWSMISSD
CTNRVVKAKLMEHHEYFFRVCAENKCGPGPTTETKTPILAIDPVAKPGEPENFHVTDIGK
NFVSLRWRKPDYDGGSPNLAYHVERKAKDAQEWERLHKGAIKETYFMADKCAENQIYQFR
VQTVNEGGESNWVKTGEILVKEEVQKPVLDIKLAGVLVVKAGESIRIEAGLRGKPQPEVK
WVKDKDTGDFNKSPRLHIETGSDYSKFLLTKSKREDSGKYVITATNSAGTFTAYATVNVL
DVPGPVRDLKVSGISVDRCRVVWDPPEDDGGCEVQSYILEKCETRRMVWSTYSSSVINSY
ANVTRLVEGNEYVFRVRAENKMGTGPAMESKPIIARTQFNRPGPPDPPEVTKIGKEEMTV
VWAPPKHDGGKSITGYILERKEKRAVRWVAVTKSPIPERRMKVTNLIPNHEYQFRVKAEN
EVGLGEPSKPSKPIVAKDPIEPPGPPGSLKVVDSTKTSVTLGWTKPVYDGGAPIIGYLVE
MRLKVEGDKQEETWKKCNISTQLVLTEFTITDLDEKQEYEFRVSAQNQVGMGRPANLKDA
VSPKEILEAPEIDLDASLRKGLTVRAGCPIRLCATIRGRPSPKVTWKRTGVDNVVRKGHV
DQIDTMTFLVIPESTREDSGKYSLTLSSPAGEKAVFVHVKVLDTPGPVGGLEASNITKTS
CQLSWSPPENDGGSPILNYIVEKREVDRKTWANVINDLKKTSFKITNLAPVTEYYFRVTA
VNKYGTGVPKDSPKSYLATDPITEPDPPKKVDILEITKNSAVLGWVKPLRDGGAKINGYV
VDYQEEGQPEDKWTPYSVVKDLSIVVVGLKEGKKYKFRVAARNPVGSSLPREAEGMFEIK
EQLLAPKILMTDVVTVKAGSKLRVEAVVSGKPAPSCKWKRGSEDVVTSNRIFVEKSLNCC
ALMIKDVSRKDSGYYSLSAENSTAKVDQILRVIVMDIPGPPEPPFEITEADIDGCTLSWH
TPREDGGSNITNYVVEKCDVSHGDWVTAVTSCTSTNCRVGKLTPGKEYYFRVRAENRFGI
SEPTVSGKMTARYPFDVPGEPRNCHVSKVFKDSMLVAWERPVTDGGSPITGYCIERKERN
SILWVKANESIVRNTEYSCSGLIEGLEYTFRVSAFNRAGQGKPSKQTEFFTARTPVDPPG
KPEVIDVTKNSVSLVWSQPKHDGGSRIIGYYVEALKLPGDKWVRCNTSSQSVPREEYIAT
GLEEHAQYQFRVIAKTAINLSLPSELSDPVTVIAENVPPRIEIGLHMKNLIIVKAGANVC
LEAEVFGKPMPKVTWKRDGQPLKLAEGMKFSQKRHLFLLELFSVTRKETGEYTILAENAS
GSKSGNIKLKVLDKPGPPASIKIVSVYADCVKMRWEPPLADGGSEITNYIVDKRETSRAN
WAQVTANISGQLTDCSVERLIEGHEYQFRVSAENKYGIGDPILTDPIFAKNPYDVPGPCD
PPVITNITKDHMTVSWKAPADDGQSTILGYMVEKRETQDVNWVKVNRKPVIDRTIKAGGL
NEGAEYEFRVIAFNKAGLGKPSDPSSAAYALDPLYPPAPPAFPKVVDTTHSSVSLSWTKP
AYDGGCEILGYLVECKRADAEDWIKCNIPKNLKQTKFLLTGLIDNTEYQFRVTAVNKIGY
SEPSEVPGKHLAKDILIAPEAELDADLRKALVLRAGTTMRLYVPLRGRPAPKVTWAKINA
NLKERQGILIKTSEWDTMLYIEDMNRYDAGKYTLTLENSSGTKTYTIVVKVLDTPGPPLN
LIVKETSKNHASITWDPPQIDGGSPIKSYIVEKRAAERKAWSTVSTDCPKTSFRITNLEA
GKAYCFRVLAENEFGIGEPCETPGAVRASEKPGPVVDFKALLITKDSCTLGWKKPISDGG
SHIIAYVVEVMEGEDKWKMLMKAKNMQYNAKDLEDGKEYSYRVKAVNEAGEGPAIELSIM
AKDQIVQPECDLRGLPDMCYIAKEGSTVRLSIPITGKPVPTVTWKKGEDLTLTDSGRVSV
ESTAVNTTLLIRDCQRTDAEKYTIILKNSAGTKESTINVKVVGKPGIPTGPIKFDEITAD
GITLEWGPPKDDGGAEISNYILEKRHSTANKWVTCASAIQKTSMRVTRLHDGMEYIFRVY
AENKYGVGECLKSDPVVARHPFDVPDAPLPPEITCIHQESAMLVWSDPRNTGGSPITGYH
VEFKDRNSLLWKRASKTPLRMKECRVTGLTEGLEYEFRVMAINVAGIGKPSRPTEPQVAL
DPIDPPGKPDVISITRSTVTLIWTAPKYDGGHRLTGYIVEKRELPGKVWMKANHVNIQSC
AFTVTDLQEGSKCEFRIRARNAAGAISPPSEQTDTLVCKDEYEPPAITIDPEMKDGLTVR
AGETIVIRASSIIGKPPPTAVWSKGGRDFKPSDICQITSTPTSSTLSIKYASRKNTGEYT
ITASNPFGIKEEHVKVKVLDVPGPPGPIAASNVSAEKVTLTWLPPDEDGGSPIKSYTLEK
RETSRLLWTMLAENIMDCRFIASKLIQGNEYIFRVSAVNQYGIGDATQSLPVKMVDSFGP
PGPPSKPEIDNVSKCSVTISWKRPVHDGGSDIQGYTVERKERRGLRWVRASKKSISDLRY
KVQGLNEGVEYEFRVTAENKAGFGEPSEPSQHVMTKDVSYRPGPPSNPRITDTTKTTATF
KWGKPHYDGGLEITGYIVEHKKEGDDDWIKDTTGTLLRITEFVIANLQPGGKYSFRVSAV
NAEGTGEPAQVEQLVEVVDREKTPDFELDAELRRTLVVRAGGSIRIFVPIKGRPTPDVTW
MKEEIPLKGRAHIDTTESYTLLVIPECTRNDAGKYILTLENVAGKKSGFVNVRILDSPGP
PINLKPREITKDSITLQWEIPVIDGGSKITNYIVEKRDSTRKAYSTIITNCQKCSFKVPN
LTEGSEYYFRVTAENEYGIGEPAETSEPVRASQAPTAPESLNVTDIGKDSATLAWTKPKH
DGGSRITGYVLEAQRKGAEQWSHLTVVKALDYTAMHLTENEEYVFRVMAVNSSGRSDPRE
SRPVVIKEQTTAPYFDLRGVYQKVVIARAGDNVKVEIPVLGRPKPVVSWKKEDQDLKQTQ
RINIENTPTSTILNISECKRKDGGQYSMTGKNILGTVTEIITVQVHDIPGPPKGPIKFDE
ISCDYIILSWDSPENDGGVPINNYIVEMRETTGTSWVELAATVIRTTFKAARLTTGVEYQ
FRVKAQNRYGVGPSIISEPVVAAYPFTVPGPPDTPQVIAFTKDSMTITWNEPNSDGGSHI
LGYHIDRKEKNSILWQKISKALVVGNIFKSAGLTDGIAYEFRVSAENMAGVGKPSKSSEP
AFALDPVDPPGQPVAINITRHEVTLHWTKPEGDGGFPITGYTVEKKDLPNGRWLKANFGN
ILETTYTVTGLKEDASYEFRVIARNSAGAISKPSKPSEAITCRDDIEEPRINVDAKFSNV
VVLKAGEVFKLEADVLGRPLPTMVWTKEGKELEDTAKLEIKTTDFSTALINKDSSRTDGG
AFTLTASNPGGFAKYVFNVKVLDRPGPPDGPLAVTDVTSEKCILSWLPPSHDGGAKIEYY
IIEKRETSRLAWTNVASDLQVSRFKVTKLLKGNEYIFRVMAVNKYGVGEPLESEPVIATN
PYVPSDPPQTPEVTTITKDSMVVCWGHPENNGGSNISNYIIERRDKTGLRWVKCNKRTVT
DLRYKVSGLTPGHEYEFRIIAENAAGLSKQSPSSPFYKACDTIFQPGPPGNPRVLDTTKS
SITVAWNKPVYDGGSDITGYIVETCLPEEDEWTIVTPKEGLTATSFTITNLKENQEYKIN
ISALNCEGVGEPACVPGSPKSEDRQIAPDIELDADLRKVVNIRACGTLRLFVPIKGRPVP
EVKWSRENGEPLDRATIESTSSFTSLQVDNVSRFDSGKYMLTVENSSGSKTAFVNVRVLD
TPGAPQNLKVKEVTKESVSIIWDPPLIDGGSRIRNYIVEKRESARKAYSTVTTSCHKTSW
KISQLQEGSMYFFRVLAENEYGVGLPVETSESIKVSEKPLPPGKVTVQDVTSNSVTLTWE
RPDHDGGSRITGYIVEMQSKGSEKWTQCMTVKGNEAVVVGLTQGEEYLFRISAVNEKGTS
DPRQLNVPVIAKDLVVAPAFKLLFSTFSVLAGDDLKVDIPYVAHPKAVVSWHKDGVPLKE
TTRVNAETTDMHLYLVIKEACREDVGQYTIKISNSAGENTADIGIVVLDKPGPPTGPIKI
DEVTADSMILSWQPPEYDGGCSINNYIVEKRDTSTTNWQIVSATVARTTIKAARLKTGTE
YQFRIAAENRYGKSSVLVSESVIAQYPFKLPGPPGEPSVQTSSKDSMLVVWNKPSDDGGS
KILGYHLESKERNSILWIKQNKTLIQDTRFKVTGLEEGIEYEYRVYAENIVGIGKASKLS
EVCVARDPCDSPGTPEAVIITRNSVTLRWTKPEYDGGSKITGYIVEKKELPGGRWMKASF
TNIIETEFVVTGLVEEQRYEFRVIARNAAGVFSNPSASTGAITAKDEVDPPHINIDSRYT
QTVVIKAGENFKIDADISGKPIPTIHWMKGDEELVNTARLEIKNTDFTTTLSVKEAIRID
GGQYTLLLKNVGGQKSVHVNVKVLDRPGPPEGPVSVYGVTSDKCSIAWKPPQQDGGSDVS
HYIVERRETSRLVWTVVDSKVQTLNLKITKLLEGNEYIFRVIPVNKYGIGEPLESEPVIA
RNPFVAPDSPTAVEVSNVTKDSMVVTWERPIKDGGSPIIGYIIEKRDKEGVRWTRCNKRT
VSELRFRVTGLLESRSYEFRVSAENAAGIGVPSASSIYYKALDPIFKPGPPNNVKVTDVS
RTSVFLTWGKPIYDGGCEIQGYIVEVCEATSEEWTMCTPPTGIAQTRFEVKKLQEKHEYK
FRVCAVNKAGVGEHADVSGTVIVEEKMESPDLDLDPELRKMITVRAGGSLRLFIPLRGRP
APEIKWGKADGEIKDTAQIDTTSSYTSLVIEHVDRFDSGKYTVTAENASGVKSAFISVRV
LDTPSEPINFRVKEITKNSVTLTWEPPALDGGAKIKNYIVEKRESTRKAYSAVVTNCHKM
SWKVEPLQEGCNYFFRVLAENEHGIGLPAETAEPLKVSEVPQPPGKITVIDVTRKSVTLA
WEKPEHDGGSRILYYVVEMQAKDAEKWSVCAQVKTLDTVVSNLAQGEEYIFRVMAVNDKG
MSDPRLLATPVQAKDLVIPPDVKPAFSNYSVQVGHDLKVEIYIAGRPKPNIIWTKDGSPL
KQTTRVNVVDSEHHTTLNIKEATKDDSGLYTVSVSSVLGQKEATFEIITLDKPGPPSGPV
RLEDISAESITVSWDPPKYTGGCQISNYIVEKRDTTTTNWMVISATVARTTLKVTNLKTG
AEYQFRIFAENRYGRSYAIDSEPVIAQYPYKEPGPPGTPFVSSLSKDHMVVEWHKPISDG
GSSIIGYHLERKEKNSILWTKINKTLIQDTRFKTTPLEEGIEYEFRVYAENIVGIGACSK
VSEGYVACDPCDPPGKPEAIIVNRHSVTLQWTKPEYDGGSMITGYIVEKRDLPDGRWMKA
SFANIIETQFTVTGLTEDSKYDFRVIAKNAAGTVSKPSNSTGSITAKDEVEPPRFEIDPE
FSQVVVVNAGDTFKLHADVQGKPVPTALWFKGDKEMENTARCEIKNTDFKAIIIIKDAIR
IDGGQYNLQLINVAGTKTVPFNVKVLDRPGPSEGPLTITGVTCEKCTLSWLPPRHDGGNA
VSHYIIEKRETSRLAWTVVANDCRATMFKVTKLLKGNEYIFRVMAVNKYGVGEPLESAPV
IMKNPFVPPGPPQELEVTNITRDSMTVCWIRPLSDGGSEIVGYIIEKRDRAGVRWTKCNK
RRVTDLRFRVTGLTEDHEYEFRLSAENAAGVGQQSPPTLYYKACDPVFKPGPPTNVHLLD
TTKNSVLIAWSKPIYDGGCDIQGYIVEICKVDEEEWTMCTPPTGLTVSIFEITKLVEHQE
YKIQICAINKVGVGEPASLPGTAKPEDKMEAPEIELDSELRKGIVVRAGGSMRINIPFKG
RPVPEISWSKDEGEIPTRAQIEKGPDFTQLSIDICDRNDAGKYTLNLENSSGSKSAFVSV
KVLDTPGAPLNLEVKDITRDCVTLVWEPPLIDGGAKIKNYVIDKRESNRPAYSNVTTKCT
KTSFRVGNLTEGGIYYFRVMAENEFGVGLPVETQDAVKVSEAPLSVGKVTLIDVTKSSAS
LAWEKPDYDGGSRIIGYLIEMQPKGTEEWVVATTSKTCEGTVTGLSSGQEYLFRVVAYND
KGKSDPRPLATPVVAKDITIEPKFKLTFNTYSVLSGNDLKIEIPVIGRPKPKITWNKDGQ
PLKETTRVNISTIPNATGLCIKEANRDDSGKYAVTAVNSTGTVTEEIVIIVLDKPGPPAG
PVKIDEVSADFVTISWEPPIYTGGCQINNYIVEKRETTTTNWQTVSATIARTTIKILKLK
TGSEYQFRVFAENRYGKSSSLDSVPVMVQYPYKVPGPPGTPFVSSVTKDHMLIEWKPPIS
NGGTDIIGYHLERKEKNSILWTKLNKILIADNRFKTNDLEEGIEYEYRVYAENIVGISVP
SKVSECYVARDPCDPPGTPEAIVITRNYVTLKWTKPQYDGGSKITGYIVERKKLPDGRWM
KASFTNIIDTEFTITGLTEEQRYEFRAIAKNAAGIFSEPSESTGPITAKDEIEAPTASMD
SKFKDVIVVNAGETFTIDADIFGKPVPDIIWLKDGKEIDKATPRMEVKTTLQRTVLTVKD
CIRVDGGHYVLSLNNVGGTKTIPVNVKVLDRPGPPDGPLKVTGITAEKCYLSWNHPSHDG
GASVSHYIIEKRETSRLSWTVVQPKIQAVSYKVTKLLPGNEYIFRIMAVNKYGVGEALES
EPVLACNPFKPPSAPSVPEASAITRDSMVLTWERPEYNGGSEIEGYILEKRDKEGIRWTK
CNKKRLNDLRFRVTGLTDGHYYEFRVSAENAAGVGEPSKPSELYKACDAIYPPGPPNNPK
VTDYSSTSVSLAWSKPIYDGGAPIKGYIVEMKEVAEDEWTTCTPPTGVETTQYTIKQLKE
NAEYNFRICALNVEGVGEHVDVPGSVVAAEKLEAPEIDLDAELRKVVSVRASGTLRLFVT
IKGRPEPEVKWAKVDSAMAERAQIEVTSSYTMLVIDNVNRFDSGKYVLTLENNSGTKSAF
VNVRVLDSPSEPLNFEVKDVKRDSVTLSWEPPLIDGGAKITNYIVEKRESSRMAYTTVTN
NCIRNSFKVDELQEGHIYYFRVLAVNEHGVGLPTETKDPVKVCEAPLAPGKVTLVDVTRK
SVTLSWEKPDHDGGSKITSYIIEMQTKGSDKWTVCATVKGLETTIDGLTSGEEYSFRIIA
VNDKGKSDPKPLGVSVIAKDIQIEPVIDLLFNTYSVRAGDDLKIDVPFRGRPLPEVSWKK
DGHSLKQTTRVNVLSSKTSSKIVIKDATREDAGKYEITLTNTIGTKSAEINIVVLDKPGP
PGAIRVDEVSADSISLSWDPPDYDGGCQINNYVVEKRDTTTTTWQIVSATVARTSIKVSR
LIQGSEYQFRVCSENRYGRSHFVDSSPVIAQYPFMLPGPPVNVRVAEATKTHMLVTWNRP
ASDGGSAILGYHLECKEPSSILWTKINRGLITDTQFKVSGIEEGLFYEYRVYAENIAGIG
KCSNASEPVAARDPCDPPGQPTVTNITRTSVSLSWTRPEYDGGAKVTGYIIECKELPDGR
WLKCNFTNVQETYFDVTGLTEDQRYDFRVIAKNAAGLFSEPSDSTGPVTVKDDVDPPTIM
MDDRFRQLVVVKAGDVLKINADIAGRPHPVVLWAKDGKEIEAKARVEISSSNFCTTIIVK
DCIRRDSGQYVLTLQNVAGTRSVAVNCKVLDRPGPSAGPLQVTGLTAEKCTLSWGPPQEN
GGAEVSHYIVEKRETSRLTWTLVYGDMKATTCKVTKLLRGNEYIFRVLGVNKFGVGEPLE
SDPVKAVDPFTVPPAPTNVEVTSVTSEAMTICWERPASDGGSEILGYVIEKCEKSGLRWV
RVNKKPVYDLRVKASNLREGCEYEFRVYAENAAGLSLPSQPSSLTKAEDPQFFPSPPTKP
KIIDSTKSSITIGWCKPLFDGGAPITGYSVEYKKTEDEDWTVAVQNTRNTEYTVVGLTSG
AEYVFVVKSINKIGLSDPSPASDPQVAKEREEEPVFEVSNEMRKTLIVKDGSSFTLTVPF
RGKPVPNVMWNKADVDLRVRASIDTSDTCTCITVEKATRNDSGKYTVTLQNVAGTSTLTL
VVKVLDSPGPPSHVEIKEVTKNSATVTWDAPENEGGAPVKNYHVDIREANKMGWTKITDS
CHRLTYKVTELQEGGVYYFRVTGENEYGLGVPSETKEGTKITEKPSPPPKLGVTDVTKDS
VSLAWCKPEHDGGSRITSYLIEALEKGQDKWVKCGVTKATHFAVYGLRENVEYFFRVRAE
NHAGLSEPKEMILPVVVKEQLESPEINMKDFPHNTVYVKAGSNLKFEIPVTGKPLPKVSL
SKDNVVVKSTIRFNSEVTPEGLIVTLRESIAHDAGRYDITASNSSGTTKSFVNIVVLDRP
SPPLGPVEISDITEDSVSLKWLPPMYDGGSPVTNFIVLKRETTTANWTEVSSAVARGTIK
IMKLTTGEEYQFRIKAENRFGISDHLDSPAVRVELPYTIPGPPSTPWVTSVTRESITVNW
KEPVSDGGNHVFGYHLQMKDRNSILWQKVNKTVIRATHFKVTNVSPGLIYEFKVAAENAA
GIGEISKASDAVLAIDACEPPVNVRISDITKNSISLVWEKPPYDGGSKITGYIIESRESP
KGRWSKANLTNIADTKFTVSGLNQDESYEFRVFARNAVGSVSNPSLTAGPVTCVDTYGAP
EIDIPPEYLDVVKYKAGTDVHLKLGIIAKPRPTIEWYKDGKELKSNAQLSIVSTKDDSSI
FIKDVSRLNSGTYEMKIKNSLGSTSAAIRVQILDKPGPPVGSIQFKTITADKITIMWDPP
VDEGGAVVTHYIVEKRETSRVMWSIISEKLEECIVSVQRLIKGNEYIFRVRGVNKYGVGD
PLESEPVVAKNSFVTPGKPTKPSVTMITRSTMTVIWERPGEDGGSDIDGYYLEKREKKSL
SWFKVIKDPIRDTRQKVQNLTEGNEYQYRVCAINKAGAGPYSNVSDFYKANDPVDPPSEP
TKLKVVDSTKTSITLGWVKPVYDGGSEITSYIVEQRVSDEQDWVVISSRDEVRTTEYVVS
HLKPGIYYFFRVSAVNCVGAGQPIEMGQPVQAKDILEEADIDLDVTMTTQYTIKAGRDLE
IIIPLKGRPAPNVTWRKADKNISSDPKYNIHNTESSTALVIPKVTRDDSGKYLLEIENGV
GEPKSITVSVKVLDTPSACQKLVVKNVTRGKATLSWEPPLIDGGSQITNYIIEKRDATKR
AYSSVTTECSNTTYKIEDLSDEICYFFRVSAENENGVGDPCETAEPVRATETPGPVKDLV
MKDTTKSSVILHWTKPDHDGGSHITDYVIEKKARDEKQWTVAGTSKRCLYEVTNLNEFTV
MDFRVFSRNEKGQSDFSQIGPITVQDLIIPLKANLADYPGGEVSVRIGQNVNIELPYMGK
PKPAIRWFKDDIPLKESEQVRFKLTENKAAFTIRNVRKDNAGKYTLTLDNKISKESFHIQ
VVTLGPPSPPIGPIRFDEIKAQSIIISWDQPIDDGGGEITCYSVEKRETSHAAWKMVCSS
VVRTTFKIPNLVKGTEYQFRVRAENKYGVSEALTSQDVIAQHQYKPPGPPGKPVVYNVTS
DGMTVQWDAPAYDGGSPITGYHVEKKDRNSLLWTKVNSSVISGRDYRIIGLIEGLEYQFR
VYAQNNAGLSIASETSKHTLAISPVDPPGTPNCIDVTRESVTLKWSAPERDGGSRIVAYS
VERRQGRGRWLRCNFIDISECQFTVTGLAAGDRYEFRVIARNAVGTVSPPSQSSGYIMTK
DESISPSIEFSAEKCLTVKAGENITINVNITGRPVPQVTWYKDGKEIDKKMMIDITTTIG
SSTLFIRDSDRDHRGIYTVEAKNSSGTKKEDILVRVQDTPGPPHGPIRFTNISAEKATIW
WSPPDNDGCAAITHYVIEKRETSRISWALVTDKCDACSFNATKLIQGNEYQFRVSAVNKF
GVGRPLDSDAIIAQMQFTVPEAPGTPDATHVTGDSITLTWTRPRSDGGNEIKHYILERRE
KKSLRWVKVSSKRPITELRYRVTNLTESNEYEFRVMAENSAGIGPASSTSRLFKCREPTS
PPSAPTVVKVTDSTKTSVSLEWTKPVFDGGMEIIGYIIEMCKASLEEWHRVNSSTCINTN
YTVTDLEAGEEYKFRVCAVNGAGKGETSEIPNSVKTVDRLTSPEIDIDAKFKQTHIVKNG
GTVCLHIAFRGKPAPLATWAKVDGELGVMVDINTTETYSTLTIENCTRYDAGKYTLSLEN
NSGRKSITFTVKVLDTPGPPGPITFKDVTRGALTLMWDAPTNDGGARIQHYIVEKREASR
LSWQEVSTKCSRQILRVTNLAAGIPYLFRVIAENQYGQGEPYEMSDPVIATEEPAPPKRL
DIIDTTNSTATLAWLKPEHDGGSHITGYVVETRAKGSDHWVFGGQTKSLHLVIEGLVENT
EYEFRVKAKNDAGFSDPREAFASVIIKEPRIEPTADLSGITNQLITCKTGSTFTIDVPIS
GRPAPKVTWKLEEMRLKETDRISVKTTKERTTLSVKDCIRGDSGKYYLILENVAGAKTFT
VTVNVVGRPGPPTGPVEVSSVSSESCVLTWAEPEDDGGTDVTNYIVEKRESGSATWQLVN
SSVKRTTIKVTHLTKYMEYTFRVCAENRFGVSKPIESQAIVAEHPFVPPSPPSRPEIISV
TANAMTICWEEPYHDGGSKVTGYWIEKKERNTILWVRENKIPCLERHFKVSSLIEGLEYQ
FRVYAMNIAGLSKASEASRPVVALNPVDPPGKPEVTDVTKSTVSIKWTEPLNDGGSKIVG
YIVERKLFSDEGEGRWLKCNYTTITETYFTVASLGDGDIYEFRVIAKNGAGVHSMPSEST
GPVTCKDEYTPPRAELDDKLVGETVTIRAGSDLVLDAAVGGKPEPKVFWAKGEKELEHGE
KYSLQYTSTRAMAIIKSCDRNDSGKYILTVQNASGIKTAAVIVKVLDTPGPCEGMITVSR
VTEEKCTLSWKMPLEDGGDSVSHYIVERRETSRLNWVLMEAECKTLSCVITRLIKNNEYI
FRVRGVNKYGPGVPLESEPVIARNAYTIPSPPGVPNIVAVGKEHVIIEWMKPESDGGSEI
KNYLVDKREKKSVRWTRVNKEYTVYDTRLKITGLLEASDYQFRVTAMNAAGNSQPSEASE
YALCREPTYTPAPPSVPRVTDTTKHSINLSWTRPMYDGGSDVTGYIVEMLEEGTEQWYRA
QQKIVKTTEYTAGGLASNKKYSFRVAAVNASGIGEFSEPSIETEPLERIEIPDLELADDL
KKTVCIRAGGSLRLFVAVSGRPTPVVTWRKPGVDLQSRGFIDVTDSYTTLTIEKVHRYDA
GKYTIEAENPSGKKSATILVKIYDTPGPPGCVKVKDYTRDSVVITWDVPSIDGGAPVNNY
IIEKREASMKSYKTVTSKCNKTLYRITGLTEGTLYFFRVLPENIYGVGEPCEISDAVLVC
DVPMIPQKLEVLDVTKSTVTLAWEKPLHDGGSKLTGYIIEACKFGTDRWMTVATLKTTVF
EHTIVSLNESEQYLFRVKASNSRGISEPREIVSPITIQEQRVMPKIDLAGIPQKTVNVPA
GKPIELHIPISGRPPPVCSWFFGGAKIKEVDRVKIETTGKYTKLEVRETTIDDTGEYTLE
VKNVTGIATEIIKVIILDKPGVPVGPLRIDEVDATSVTVSWAPPEKDGGANISGYVVEQR
DAHRPGWLPVSESVTRPTFKFTRLTEGTEYVFRVAATNRFGIGSFLQSEIVECRSGKTVP
GAPSRPEVFDVSHDGMTITWLPPEVDGGSQVSGYIIERKEVRSDRWVRINKNPVTMTRYR
STGLIEGLEYEHRVTAINSRGHGKPSPTSKPAVAMDPIAPPGVPLNPRVIDTTRTSVSLA
WSPPEEEGGSSIIGYLIEMQKIDQIEWTKCNTTPVKICEYTLTHMPQGAEYRFRVMACNA
GGPGEPAEVPGAVKVTEMLEYPDYELDPKYSEGVVVRQGGVIRLSVPIKGKPIPICKWTK
DGRDISHRAMIATSDELTELVIKESHRDDTGTYDLVLENKCGKKAVYIKVKVIGWPDAPE
GPLEFDDIQARSVRVSWRAPSDDGGSDILGYIVERREVPKAAWYTVDSRVGETSLVVKGL
KENVEYHFKVSAENQFGVSRSLKSEQSVTPKTPLCPPEPPSNPPEIMDVTKSTVALSWSR
PKDDGGSRITGYYVDRREMSTEKWVRHNKTQITTTMYTLTGLIPDAEYQFRIIAQNDVGQ
SEPGPSSESVVCKDPFDKPSQPGEIDIISVTKDSITIHWQRPECDGGKEILGYWIEYRQS
GESAWKKCNKERSKDRQFTMGGLMEATEYEFRVLAENESGLSRPHRTAMGIKTKLSVGEA
PSLKEEMEDVTTKLGQSGTLKCQIIGRPLPEIKWYRFGKELIQSRKYKMSSDGRNHSLTV
VTDEQEDEGLYTCRAINDAGEIETSGKLFLQAAPQFHSGFPLKEIYYAGCGTSLRLHVVY
IGRPVPQIMWFYGKKPLKPSDNIIIENTENYSHLVVRNVQRKTNAGKYKVQMSNIFGSVD
TVLRVEIQDKPAMPEGPVVVDALLKNSVIISWKPPADDGGAMITNYVVEKREAKEGEKYH
LVSSSISGTSCRVPNLLESAGYYFRVSAQNQFGISDPLEIPSVVIIKSPFEKPGIPQQPV
VTGVTKDSCVVTWKPPTSDGGAKIKNYYLEKREKKQNKWIAVTTEEIHETMYNVKGLIEG
FEYEFRVKCENIGGESEWSEVSAPVVPRSDTAVRAPGFKEELRDMSVKYKSNATFVCKVT
GHPSPVVKWYKSGKEILPDGKKIIVQEFKGGYHQLVISAADEEDATTYQIRATNQEGSIS
TTVTLEVEVPAKIHLPKHLQGMGAVHALRGDVVTIKIPFSGKPDPVITWQKGQEIIDNSG
HHQVIITRSFTSLVFPNGVQRKDAGYYIISAKNRFGADQQTVELDVADVPDAPKNIMISD
LSRDSVTLTWSAPASDGGSQIISYILEKCPTSGDRWIRVAQTQDTHYTVSVIGKTQYQFR
VIAENKFGQSKPSQPTEPVVTKEDKSIIRNYDEEVDETREITKEEAPSSSMKTLSAMYSI
AEELGRGQFGIVHRCVETSSKKTFMAKFVKAKGLDQALVEKEIETFNMARHKNILYLHET
FESLQELVMIYEFISGVDIFERLGTANFDLTEQEIVRYIRQVCEALQFLHSHKYAHFDIK
PENIIYTTRKSSNIKIIEMGQARLLIPGENIRIQFTAPEYCAPEVHQHDMVSTVTDMWSV
GVLTYVLLSGLNPFTAENAEKMIEKIYNVEYSFDAEAFKDTSLNAMDFVDRLLTKDRKHR
MTAAEALEHPWLKMKTEQLSTKVIKTLRHRRYYHTLVKKEYNFVVSAARIAYGGAIRSQR
GVSVGRVKIAPYEQGVKAGQIMHGVAEEGGHVRFVCHIENYDTTTEVTWYFGARQLEASH
KYEISYSNGVAVIYVKDIAAADDGTYRCKVVNEHGEDSAYAELFVEGVRSYREYFMERTV
KKVKRRIDTTRLIQRPPEFTLPLYNRTAYTGENVRFGVTITVHPEPQVTWLKSGQKIVPG
DDDKKYTITSDKGLYQLVIHNVQTEDDAEYTVVAQNRFGDDSCTARLTVTPHPIIADTMK
PLFKRLLANVECTEGESVRFELRVTGSPTPALKWEKDNLTLAFGPKIEVIQEDLEYYVLH
IRETLPEDSGTYRVTASNSAGSASCQATLKVDRVTYAKREYRNEEEREKYVQRQIGKTLK
LAQYLSSTEVTPLNPVAQEALKEAAHLYKPAVSTKHVQGEFDIEEEQEERKIQIEEKRIR
MPYEVPDRRVHAPSALEDKRIKHFVPLSEMKWYKKLSDQYQIPERMERYVQKRQKRIRLS
RWEQFYVVPLPRVTDQYKPRWRIPTISRDDLETVRPSRLRTPSPESESLYRLRRRSLGDL
SDEELLLPVEDYLSLKRTEEERLRLEDELELGFSASPPSHSPVRFELSSLRRLSPRQKTY
EEVEEEEAELHRLHTKQKATGKRHASYKEREAHVSSVTKETLKAVEQVHTTPSVSHFLRR
RRSLSPTYIELMRPVSELIRPSRAHLALETEDEASERRSPTPERTRPRSPSPVSTERSSR
SSSRFERSARFDIMSRYEARKAALKSERKYEVVIQQPFSLDHSPRITVRMRSHRVPSGQN
TKFTLNVQAKPEAEIKWFHNGQQIQESSKYHFTNMSGVLTLQVFDCQAEDSGTYRVVCTN
SKGEASDYATLDVSAGEYSTYSSRRKDEEPPATFFPEMTKTDFYHVSSLKTASTSETHIE
VKETKSKLTETHAVHAYASSEKKEKIMEAKKEEEITFHMKGKATMPARILTKPQSLTVSE
GETARFTCDIDGEPAAFVTWMHEGRTIVSSHRYHVTTTQYKSTFEISSVELSDEGSYTVT
VQNSEGKQSAQFNLSIRRAVQKEKIASSHKVKSPEPRVKSPEPAAARSPEPHVKSPELIK
LSKVKSPESRLKSPEPTATKGIECQIKSPEPFKSPKRITSPEPDTSPQKIRSPSTLISQK
GKIPPKIMQQLKAEAYEDKVKMSCVAESSINEVVWYKDGKKLTQGSHYHFHNSADGTCSL
SVHDINESDQGEYACEIIAEGGVSRTSFSFVGQVFHTIYTKITTFMETKKSFQKKEVDSS
AITSLKYAKALQTEAQKEAVSASHKKTEVKEQIVKKEIFYEEVQSYTEVKASHTEVTMQE
GQSLTLKANIPGASTVRWILNGEELINSGEYRYGVSGNDHTLTIKNVSQREEGIITCEAK
TEEGIVKCQFDTTVTSKRANAPSFLVQPKSQNVNEGQNVIFTCEITGDPTPEIEWLKNNV
LVCLSSKLKLSRSKNVYTLEIKEASISDSGKYTVKAKNMYGQCSATASLNVLALVEEPTK
MIVLEKSATAASVHEGFSTKAVHMATSMQEASFRSSSMAEVKIESMSATSMSSMTSESMV
AMSSSSRMEMSSHSHIEGSSLRTIKHSHQGSPPKIEALPEDISIEKGKVLTISCAFSGDP
VPEIEWTRSGRTLPSAEDSGRFHVETAEDLTTLIITNVKEKDAGAYTLKLSNELGSDTAT
VNISIRSL
NT seq 95427 nt NT seq  +upstreamnt  +downstreamnt
atgactacacaggcgccaacattcatacaaccgctgcaaagcgttgtggcacttgagggt
agtgccgcaacgtttgaggctcaaattagtggtgttccagttcctgaggtgagctggttt
cgtgatggccaggttctttccgctgctgctctgcccggcatacagatctcgttcagcgaa
ggccgcgctgtactgatgatccctgccgtgacagctgcacacagtggacgattttccgta
cgagccaccaatggtgccggacaagccactagcactgccgaactgcttgttacagcggaa
actgcgcctcccaacttcattcagagactacagagtatgaccgtgagacaaggaagcaga
gtgagactggatgttcgcgttacgggaatccctacacctgtggtgaagttctacagggag
ggcgctgagattcagagctccgccgacttccagatccttcacgagggcgaccgttacagt
ctgctgatcgctgaggcttttcccgaggattctggaacgtactctgtcagcgccaccaac
agcagcggccgcgctacttctactgctgaactgctcgtccagggtgaagaagaagctgtt
cctgcaaagaaaaccaaaactattgtgtccactgctcagatacctcagattcgacaaact
cgagttgagaagaaaatagaagctcgttatgaggctgctgcagctacgatggcgatacgt
gtggaagaaggtgctgttgctgaacacctgcgacacaaaacccccccacgtgttccccca
aagccaacgtcgaagtctccaacttccacactagtgtcaaaagtagcaggcacacgtcaa
caatcaccttctcctgtcaggcatgtcaaggcacctactccaacgcctgtgaggtctgtg
tctccctctgcaagactgtcagtgtcccctatcagacctgttaaatctccagtaatgacc
cgaaaacagcccactccaagtactgatgtcctccctccctggaagcagggagattatgtt
gctgaatcaagttatacccgcatgattgctgctgctgaacgtgtccagacctctgctact
cgtgttcaaatggagcagcgatgggaggcctcctatggggcacagcagcaagtgactgga
gttgcaatcaaagaggctgagggagggaaaaaggcagaggcggtggccacagtgcttgct
gctgttgacctagcgcgcattcgaaagcctgcacaggccgagggggttcgaactgaagag
gagatcgtagagcgtgacttaaaacagcaggccctgaccaaacagacctccaaacagcaa
gtcacaactgtaacaatgaaaactgaggctgttcaaacaccccctcctattgtccttgct
gaagacagtgtcagtgtttctcagatcaagagaagtaaggaaactcccatccatgtggac
cctgcgcttgcaccatccccaagtcctcatttcacagtttctaaagttactgttcctaaa
catgatcatagttatgaggtctcaatagcaggttctgctattgctacacttcagaaagag
ttatcctctactactgcttctcaaaagatcatcaggcctgtgaagcctccttctcataag
attgtggagaccagagtgatgtcagaacaagtcctgccaccatttagagataccagtgag
agatatcaggcatctttcaccacatccatgcagaaagagatagggctttcttttacagga
gggatggagcaaacacatgtccagttggagaaagaggtggttgaagctgcagcagtcccc
tcacctgcacaagaagctgtggttcctcccactcttgtagtcggtttgaagaatgtgact
gtcactgagggagaatcggtgactctggagtgccagatatccggtcacccagctccaagc
atcatgtggtttcgtgaggactatagaattgagagttcgatagacttccagatcacttat
gaaaatggatatgctcgtttggttatccgggaggcctttgcagaggacagtggtcgcttt
acttgcacagctaccagcgaagctggaactgtcagcacttcctgttacttgcttgtgaag
gtgtcagaggagattgagagcagagaggaaataatcactgctgtctctgcacacatggaa
actttagaggagaaacgcattagtactgaagtcaaagaagaaatattagaagtgcctgct
agtgcagaagctgtggcacctttcttcgtgaggaaacccacagtgcagaagcttgtggaa
ggtggcagcgtcatctttgaatgtcagataggtggtagtcccaagcctcacatttactgg
aagaaagctggagttccccttacgactggatacaggtatagagtaacctacaataaggaa
acgggcgagtgcaaactggagatttccatgacctttgctgatgatgcaggagaatattct
atctgtgccaggaatcagctgggagaggtctctgcatcagccagtttacttgaggaagag
gaatatgaagcctacatgaagatgcatgaaatgactataatgactgaaggaatcatcatg
gtgcaagaacctagagtagcagacgtccctccagtggtcatgaccgaatatgagagggaa
cagattcttatgcagaagaggatgacgcagcagacacagatgctgaagacatttgtaact
gaacaggaattccaaatctctgcttttgaggagaggataatccgtgagattgagctccgc
attctgaagattacttaccaggtgttagtaaccgaagatggggaggagatggtcatgagt
gtagctgaacacgaagctgtcgagccagtctttgacacccctgtaaagaattacaggatt
ttggagggaatgggagttactttccactgcaaagtgtcaggaaatcctttgcctaagatt
gcttggtacaaagatggcaagcgcatcatacacgggggacgttatcagatggaggttcta
caggatgggagagccagtctccgaattcctgtcctgctgccagaggatgaaggtgtctac
actgcttttgctaccaacatgaaggcaaatgcagtcagctctggaaaactgtatgtggaa
cccactactgtagttggagctcagccgtacttcccccaaccagaggctatcaggagaatc
agttctacttctcctcgctcattgagtcgctctcctggacgttctcctggtcgctctcct
gctcgcagactggatgagaccgatgagagccaactggaaagattgtacaagcctgtattt
gttgtaaagccctcctctttcaagtgttcagaagggcaaactgccagatttgacttgaaa
gttgttggtaggcccatgcctgaaactttctggttccacaatggccagcaaatagtgaat
gactatacccacaaaatagtggtgaaggaagatggaactcagtcactgattgtcgtccct
gccctgcctcatgactctggagagtggactgtggttgctcaaaacagagctggaaaggcc
tctgtctcaatgactcttactgtggatgctaaggaaaacttggtcagaccccagttcatt
gagaagctgaaaaacattagtgttaaggaagggactttggttgagctggctgtcaaagct
attggaaatcctcttcctgacattgtctggttgaaaaacagtgacatcatttccccacaa
aagcaccctcatattaggattgaaggcaccaaaggagcagctaatttcaagattgcatca
acaactggctctgatagtgcctggtacacagccacagcaatcaacaaggctgggcgagac
actacccggtgcagggtcaatgtggaggtagagtttgctgaaccagaaccagagagaaag
cttatcattccgaaaggaacatacaaagccaaggagattgctgcaccagagctagaaccc
ctgcacctccgctatggtcaagagcagtgggaggaaggtgatctgtatgacaaggaaaaa
cagcagaagccacacttcaagaagaaactcacatcagtccggctgaagcgatttggccct
gtacactttgagtgcaggcttacacctattggtgatcctacaatggtggtggaatggctt
catgatggcaaacccctggaggctgccaataggctccgcatgataaatgagtttggttac
tgcagtctcgactatgaagtggcatatgccagagatagtggtgttgttacttgtagagca
acaaataagtatggagttgaccaaacttctgctaccttaattgtgaaggatgaaaaaggc
cttgtggaggagactcaactaccggagggtcggaagggaatgcagaggattgaagagatg
gaacgtttggcccatgaaggtgctcttgctggagtcacagctgaggagatttctgagaag
accaaaccagagattgtactggttcctgaacctgcacaggtattggagggtgagacagca
aggttccgttgcagggtgactggttaccccacacctaaggttaactggtaccttaatgga
caactaatccgtaaaagcaagcggtttaggctccgatatgatggtatttactaccttgag
attactgacagcaaatcttatgattctggagagatcaaagttgtggcagaaaaccctgaa
ggtgtgagtgagcattgtgtgaagctagaaatccaacagagagaggattttagatccata
cttcgccgtgcccctgaattgaaagctcctgaatctgggacttctccagatcgtggcaga
gtgtcctttgaagttcaaaaggttgacaagcctgttgacactactcagcctaaagagata
attaagctaaggaaagcagagagagttgttcatgaaaaatccacagaagagacggaggag
ctgagaagtaaatttaagcgtcgcacagaggagggctattatgaagcaatcactgctgtt
gagttcaagtctcgtaaacgagatgattcctatgaagaactgctgaagaaaacaaaagag
gaacttcttcattggaccaaagatgtccctgaagaagaaaagaaaaaggaagaggaaaga
gggaaagtgactattccaaagattaaaccagagagagttgagttatctcctagcatggaa
gctccaaagatcatggaacgcatccagagccagaccgtttcccagactgatgaagtccgc
ttccgtgtcagagtggttggtaaacctgatccagaatgtcagtggttcaagaatggtgtt
ctcctagagaagtctgaccgtatttactggtactggcccgaagacaatgtgtgtgaatta
gtaataagagatgtctcagctgaagactctgctagcattatggtcaaagccatcaacatt
gctggggaagcttcaagtcatgcatttcttctggttcaagccaagcaagctgttgtcttt
actcaagaacttgaagatatcattgccaaagagaaggacaccatggtaacatttgaatgt
gaaaccagtgagcccttcgtaaaagtaaagtggctgaagaacaacatggagattttctct
ggtgataaatatagaatgcactctgacaggaaggtgcatttcctctctgtactgatgatt
gaaatgaaggacattgcagaatacacttgttgtgttgttgaagatgaccatattagaact
actgcgaaactcactgttgagggtgctcccctggacattctgacagcgctggagaatata
gaggttcctgagacctactctggagagtttgagtgtgaagtatctcgtgaagatgctgag
ggtacctggtattttgagggaaaggagatcactcccagtagcaaatatgttatgtcatct
cgtcgaggacgccattctctttgtgtaagagacgtgaaaaaggaggaccagggaaaatac
agttttgttgttggtgacttgaagacagctgcctccttgacgatgaaattgcgacctgtt
acgttgatgcaaggcctatcggacctttccgtctgtgaaggtgacatcgtacaactggaa
gtaaagttctcccaggaaaatgttgaaggcatctggatgagaagtggccaagccatcttg
gccactgatcgcattcacattgtcattgacaagcttgttcacaaacttcttattgaagat
gcccaaaggagtgatgctgggatgtactctttttttgttcctgctcaggacataacttct
tctgcaaagcttactgttcagtctattggtatcttgacaccgcttaaagatgtgacctca
gttgaaggcactaaagctgtgcttgaggctaaaatctctgcagcagatatcagctcagta
aaatggtatcataatgacaagctgattgtgccaagcgagagggttcagtttgttgctaaa
gggtcgaaacagcgattggtctttagcagaacgtttgcctcagatgaaggatgctataag
ctggttgttggcaaagctgagaccagctgcaatttaacaattgagaaaattgagattttg
aagcaaatggaggaccagatgtgcaccgaaacccaaaacgtcacttttgaagtagacttg
tctcactctggtattgatgctgtgtggaccttcaaaaatcagactcttaaagcaggagcc
aagtacaagatggaggccaagggcaagcgctataccttgactgtcataaacacaatgaag
gatgaagaagggctgtatacctttgcagctggtgaaaagacaacaagtgcaaggctaagt
gtaacaggtggtgctgttaaaagacctctccaagatgtgactgtagcggagtcccagact
gctgagttggagtgtgaggttgccaaccccactgctgagggcaaatggctgaaggatggc
catcctgtagaattcagtgacaacatcaggagtgaggaatttggagctgttagaaagctt
gtgatcatcattacaagacctcaggacattggggaatacacttaccaggttgcaaattct
acaactacaggcaacctgaaagttgaagctgtgaaagtaaagaagacactgaagaaccag
actgtaactgagacccaggagacagttttcagtcttgaactcacccatgagaatgttaag
gggtcacagtggattaagaatggtgtagagatccgccccagtgacaaatatgagatcaga
gtagatggcatggtccacagcctgaagatcaagaactgcacaacacaagatgagtctgtc
tatggattcaaacttggaaggctctctgcaaatgcaaggcttaatgttgagacaattaag
attgtgaagaagccaaaggatgtgacctctctcgaggatagtacagcctcctttgagcta
agtctgtctcatgacaacattccagtgacatggatgtttaacagtgttgagctgaagccc
agtgaaaactgtaagattctgtctgagagaaaggctcacaagctgataattcagaatgtg
aacaaacacaatgctggagaatacacggccatcattgggcacttgcagtgcagtgccact
ttatatgttgaatccttacggatcacaaaaaccatgaagaatattgaggtccccgaaacc
caggtggctagctttgaatgtgaagtgtcacacttcaatgtcccatccacttggctgaaa
aatggagtggaaattgagatgagtgagaaattcagaattgtagtacagggaaaacttcac
cagctcaagataatgaacaccagcagagaagattcagcagaatacactttcatctgtgga
aatgacaaagtttctgccactctaacagtcaatcccattttgatcacgtccatgctcaaa
gacctcaatgctcaggagagggacacaatcacctttgaggtgaatgtaaactatgaagga
ataacttataaatggttgaagaatggtgtagagatccgttccacagagagatgccaaatt
cgttctaaacaacttactcactcactgaccatacggaatgtacactttggagatgttgga
gaataccagtttgttgctggatctgcagcaacttcagccaacctatatgttgacgcgcgt
gttattcaaattacaaagcacatcaaagatatcaaagtaatagagaagaagaaggctgtt
tttgaatgcgaagtttctgagccaaatatccaagtgacatggatgaaagatggacaggag
ttggaattatctgaccgatacaaggtttctactgaaaaatacctgcacaggctgttgatc
cagactgtccgtttgtctgatgctggagagtactgtgtggtagctggttctagtacttct
aaggctcagctcactgtggagggccgtgatgtccggatcacagatcttgtggagaaagag
attactgttgttgaaaagcagagggcaacatttgagtttgaagtcaatgaagatgaaatt
gaaggccgttggctgagaaatggcattgagattaatttttcagttgaagagcggttcaac
tatgtagccatcagaaaaattcatcgtttaaccatctctgaaacatatcgcagtgatgct
ggagagtacacatttattgctggcaggaacagaagcatggttacactccatgtcaacata
cctgagccaccacagattattcagcacatgaagccccagtctgttgaggctggcaaacct
gcccggttctccgtagtcgtgacaggcgttcctcagccacaggtgttctggtacaaaaac
tcccagatcctgtcttctgggttcaagtgcaagttcttacaagatgggaatgagtacaca
ctacttctcgttgaagccttccctgaggatgcagcagtctacagctgtgaggctaaaaat
gaatctggagaggccaccagcagtgctgctttaaatgttgaagttcctgaggtgatttct
cctgatactggaactccactgtctcctcctgtggtcctttctcctatttacaacacctct
gttaaagaaggagagtcggctcgcttccagtgccgtgtctctggagaagacttgaacatt
ttctggtactctaaagacaaggaaatcaagcagtccaacatcttcagaatgtcccagttt
gatgataactgccaattggagattgctagagtttattctgatgatgcgggagagtacact
tgtgtggccagaaatccagctggaatggtgtcttgtgctgcctttttgactgttgatgtg
atcaaagtagaagaagagatggaagccaaaattgaggaggaaatcaaagtggcacctgtt
tttaagcacaaaatccaacctttggaagtcagtgttggcaatcgtgccaagtttgagtgt
gagatagaggaagcacccaacgtgaaattcaagtggtataaggctggcatcgaggtgaga
gagagtgagaagtgcaagatcttcagtcatcacctgaccacctcgatggaacttttaaac
ctaaccaaagctgacactggagaatatacatgtaaagctacaaatcaacatgggagtgac
agttgttcagctttcctgaatgtgtctgaagttttcccaccagtttttactaccaagcct
gaaccaatgacattatatgtgggaaaacaagccagcattcagtgcgtagttactggctct
acaccactgagtgttgtgtggcaaaaggacaatgtttccatttcttcgggagaaaactac
cgtgcatctgtggacaagaacagatatacacttgaaattgtcaaacttcaagttgctgat
cagggcacttacatttgcaaagcatcaaatattgttggaacggacatgtgttgcacagaa
ctgagtgtaattgacaagcccagttttgtaaaaaccttgacaccaatgacagtagctgtg
ggcaacccgctacgcctcgagtgccaggtagatgaagacacaggagtgggtatcacttgg
accagggatggcaggaaattgcataactctatggatcttaaacttacatttgaggacaag
attgcagctcttgagattccacatgcaaagcttaaagacacagggacatacacctgtaca
gctgcaaatgatgcaggaagcagtagctgctcttcgacaataactgtccaagaaccccca
accttccttaagagattggaacccaagatcctgtggaaacagggtgctacggcacgaatg
cagtgcactgttaagggctcacctgagctccatgtcacctggtttatgaatgacaaagag
ctgaccactggagagaagcacaaaatcacattcaaagatggtcaagccaccctagaaatg
tctcatcttactgtggctgacagtggacattatacgtgtgaagtgttaaatgaagctggt
tgtgaaagctgcagtagttctgtaactgtaaaagaacctccttctttcaaaaaggaatta
cagacagtagaagtagtaaaggggaccactgctttatttgaatgtgaagtaagtggcaca
gctccatttgaagtgagctggtataagaacaagaaaccaatttcctctgataaaaagtat
aaaattgtatgtcaggacaacatagcaactttggaggttaattcatttgaaagtgcagat
atcggggattaccagtgcgttgtatcaaatgatgttggtaaaatctcctgcaagtcaaca
ggcagattaaaagagccaccttcattcttcaagaaaattgaaaacacttctgccattttg
ggaaattctgttagactacaaggaagtctaaaaggttcagccccaatcactgtcaaatgg
ctaaaggattctgaaattctgagtgctgaagatgatgccaatgtaacaatgacatttgag
aataatgttgctgttcttgctataaaaacggtgaacgtaacacacagtggcaaatatact
tgccaagctgaaaacgaggctgggaaacagcaatgtgaagctactttgtcagttgaagaa
cctgctcaaattgtggataaaacaccatctgttagcgtgactgcaggcgagccggtgact
ttagagtgcacggtgtcaggaagcccagaactcaaagtgaaatggttccgagatggcaag
gagatgactgcaagccggaagtataaaatgatgtttaaggacaatgtagcagttttgaaa
attcttgcagcagaaaaaggagacagctgtgaatacacagtagaagtggcaaatcgtgtt
ggcaaagatcagtgctcgtgttctgttactgtgttagatcgaatcattccgccatcattc
acaaaaaatcttaaaaaaattgatggaaatattggcatgaatgtcagtatggagtgcaaa
gtttctgggtctcagcccataacgatttcgtggtacaaggatgagaaagaaataaaagcc
agcgcgaaataccagatggatttcaaagagaatacagcagctttgggaatctttcagtta
gagaagtctgatgcaggactgtatacctgtcgggcaacaaataccgcaggatacaaagaa
accagtggaaccatgtctgtgaaagaacctccggctttcatcattaaacctgattcccag
gatgtaatcccgggatctaccgtgatcctaaaaagtgcttttaccggaacaccaccattt
actatcaaatggttcaaaggggatgaggaaatgtccaccggaggaacatgttttgtcaag
aaagatgcatcttcaactttcatggaactgcactcggtgaaacccactgattcagataat
tacacttgccaagtggccaatgatgctgggaaagtgacttgcaccgctatcttgtttgtg
aaagaaccgccaaagttcgtaatgaagcttgagtcttccaaacttgtaaaaagtggaagt
acgattatcttggaatgcaaagtaactggcagtcccacaatcaaaattaagtggttcaag
aatgagactgaaatcacttctgatgataaataccaaatgaccttcagcaactcggtagct
actctacagattgtcaagagcgctgttgatgacagtggccactacatttgtgaggcatct
agtgaagccggttgtgaccgatgtaactgtgtagttacagtcaaagaaccaccaacattt
ttgaaagcctttgaatccaaagaagttgtgaaaggttctgatgttgtgttggaaggaaat
atctcaggttcatctccttttgaagttacctggtatagagacaataagataataagaaat
gataagaaacacaagataaacatatttgaagatgcagttgccctccagattctgaaatgt
gaagtcggagatgttggaaattatcagtgcatagttacaaatgaagtaggagagtcttct
tgcgactgtcaggtggcattgaaagaacccccaagttttgtgcaaaaaatcgagaacata
aattctgttgtaggcagtgaaataacaatgcagtgctctttgaagggatctttgccaatt
gctattttgtggctaaaagatgatcgtgagcttaaagaagatgaaaacataaagtttttt
tatgaggatcaaacagtgcagctgcatatcacaaatattcaactaaaacatgaagggaag
tacatttgccaggcaaagaatgaagctggaagtcaaaaatgttctgcctcgttgattgtt
aaagaaccagctcacattactgaaaaagcaaagtctattagtgttacagctggggatcca
gccacactggagtgcagattttcaggaactaaagttcttaaagccaggtggcttaaagat
gggaaggagttgacaactggtcaaaagtacaaggttcatcacacagataagaattcaatg
ttaaagattctttctgctgacaagagagatggtggagaatacatttttgagatttccaat
gatgttggtagcagcacttgtgaagctacagtcacagttttagatcaaataatcaagcca
tctttcacaaggaaactgaaatcagtagacagcattaaagggtcatttgcccatctggag
tgcctgatctctggttctctccctataaatgtatgctggtacaaagataataaggagata
acagctgatgacaagcacaaatgcactttctttgaaaacacagcatttctggagatcagc
cgactcgatagctcagactctggcagttacacatgcattgccaaaaatgaagctggcagt
gaccagtgctctggcacgttgtttgttaaagagccccctattattttagaaaagcctaac
tctgctgatgtcttgcctggatcaagagtgcaattcagtgtactgtttagtggtactcca
ccactgaccattaagtggttcaaagacagtaaggagattttatccagctcccaatgtgcc
attcagaaggataatacctccagtttactggagttgttctttacgaagacatccgattct
ggagagtactcgtgtgaaatctgcaacgatgttggctctgaattttgccaagcagcgctc
tttgtgaaagagcctccaaaattcaccaagaaacccgagagaataacggtaacaaaaatt
ggacaaactgtgagatttgaatgccaggtggttggcacacctgaaatagacatctactgg
tttaaagatggaaatgagatcagtcccagtgacaagtttaaaatgtcatatgagaactcc
ttggtgagcttggagatattgtgtactgaaactaaagacagtggagtatattactgtgag
gcacgcaatgaagcaggtagtgaaagctgcagtatggagctgaaagtgaaagagccccct
gcttttgtacaggaattaacacctctcgaagtcgtaaacggctccgatgcctctttcaaa
tgccaagttacaggcacgcctccgtttgaggtgtcttggcaaaaagatgctaaagaaatc
acacctgacaaaaggcacatagttttacagagcaatggttttgtcagctttgcaatactg
aaatgcgaggcattagatgttggtgactatcagtgtactgtcgcaaatgaggtgggaaaa
tgctcttgcgcagctgcgctgcgcacgaaagaaccgccatcattcgtgaagaagatccag
aatgttgctgttttcttgggaaaaacggctgaatttcagtgtgttgtggcgggttcacct
ccactgactgtgcagtggcaaaaagatgaagactggcttgtggaagatgctaatattgaa
cagaagtttgaggacaatactgcctctctaagaattatggcttgtgaggctagccatagt
gggagatacacttgtcaggtcacgaacgaggcagggcttgtgaagagctttgcgaccctt
gtggtgcaagaaccaccccagattacagaaaaacccgagatgataaatgtgacagctggc
gatcctgtcagtttcgaatgcaaagtgtctggcactccagagctcaaagtcagatggcta
aaagatggaaaagagctgacatccagcagacactacaaactcagttttgaaaataatatc
agtagttttaaaattcagtctgcgcagactggtgatggtggagactatatgtttgaagtt
gctaatgcctttggagtgtgccattgcaaagtcactttagttgtactagaacaaatcatt
gctccttccttcctcaaaccactgagggaaatgcatgaagttttgggatcttttgtgaaa
atccagtgcacattctctggttctcttccaatttctgtcgaatggcagaaagatggtaat
ataatttctgctggaacaaagtataaacttcttcaagaagacaactatgtgtccttggat
atagagcacttagagaaagctgatggcggtgaatatgtttgcaaattgacaaacaaagca
ggaacttgtgaatgcaggggttcgctgatagtaaaagagccaccaggttttgctttaaaa
ctggaacctcaagccgttcttcctaattctacggtgcgatttaagagtactttgaaagga
acacctccatttacagtgaaatggttcaaagaagagacagaactgattactggaccctca
tgttttactggattggaggggtcttcatgctttttagacctttatactgtcggagtgccg
caaagtgggatttatacttgtcaagttagcaacgatgctggtacagcaaggtgtactgct
gaattactggtgaaagaacctccagaatttgtactgaaactgccacccactaagtttgtc
aaacaatatgaggcactgcgtcttgaatgcaaagtgattggcactcccttaattcgaata
ttgtggtacaagaatgaaaatgtaattgctgaaggtggaaactacaagatgtcatttgta
gactcagtggcagttctcgaaattcccatctcaagatttgaagatgatggcatctataca
tgtgaagctcaaaatgatgctggaagcattagctgtagcacaacactcatcgtgaaagat
ccaccatctttcatcaaagtacccacatctgtggaaggcacacgaggaagagatgcaagt
cttgactgtgagctaaaaggaactccaccttttgagatcacctggtacaaagataaaaag
cccgtcaaggagagtagaaagtacaagtttgttcttgagggttgctcagttactctgcat
attctcagtttggatgcctctgatgttggtgaatatcagtgcagagcattgaacaatgta
ggaagtgacacctgcagtagcacagttaaacttagagagccacctgtgtttgtgaagaaa
ttgtccaatctgtcagtcatttctggtgaagaggcaacatttattgccactgtcaaaggc
tcccaaccaatgacggtgtcttgggtgcaagacaaagaccatgttctgagagatggtgac
aacagaaaaattacctttgaagataaccaaaccaccctaagaatttttaaggctgatgaa
acctgtgccggcaaatacacatgtcaagttaaaaatgattccggagttgtggagtctgtt
gctaagttaactgtgctagaacctgcatcaattgtggatagacctgagtccttcagtgtc
acagcaggagacacagctgcattagaagttacagtagctgggacaccagagcttaaacca
aaatggtttaaagatggggtagaactgtcctctggcaaaaagtacaaaattaccttctca
aaaatggtgtctactctaaaggtcctttcagtagagagtcttgactctggagagtacaca
tttgaaattaaaaatgaagttgggtgtgacctctgcaaaatctctctgactgtcttagat
aaaatcatacccccaacgttcatacggaagttgaaggactctcatctgatcgtgggtaag
cctggccagatggactgtaaagtctcaggttcaccgcctttcattatttcttggtaccat
gatggagaagagataacaagtggaccaaaccatgaagttgccttttgtgacaacacttgc
accttgaatatgcccattcttaaactctctgattctggggtttacacatgtaaagctgta
aacactgctggggccagtgagacaagtgctactttgtatgtaaaagaaccaccttctttt
gttgaacgaccacaacctttggaagcactgccaggcacagatgttaccttttcagccatt
gtcaaaggaagtgctccacttaaactgaaatggttcaggggtagcaaagagattatatct
gggcaaggatgtgaaattgcccttcaaggaaatattgctactcttaagctgttcaagatt
gataagtcccatgcaggagagtatacatgtcaagtaattaatgatgctgggaaggaaaat
tgccctgtcagtctatttgtaaaagaacctgcacattttgtaaagaagctgaaggacctg
gctgttgaaataggaaaattgctgtttcttgaatgcacatatgctggaagcccagaaata
caagtgaaatggtttaaagatggtcatgagctctattcctcttacaaatataacatcaca
accactgagagctcctgcatacttgagtgtctcaactgtgacaaagatgatagtgggaaa
tactcctgtgaagtttccaatggagctggaagtgattcatgtcacactcaagtgtccatt
ttagaaccaccatactttattgaaaatttggaaccaatggatgtgactgttggagatgca
gtttgtctgaaatgccaaataggaggaacacctgaaattaaagtttcatggtttaaggca
gatgggaaagtgcggtcttctgctgcctgcaaaatggagttcagcagagggattgcctgc
ctgaaattatctaaagtttgcaaaagtgatattggtgaatatacttgtaaagctgaaaac
cgcataggatctgcatcttcaagttgtcgcttaacagtgcaagaggctaaaacaccacct
tctttccccaagaaaataatgagccttcagcagactgaaggacagccagttagatttgaa
tgccgtgttgcagggtcttctcctatggaagtttcttggcttaaagatggtgaatcttta
caacacggtgatgaatactcaatgtcttttgatgataattccgctgttttaaccatatcc
agaggtgaaatgagacactcaggggaatatacgtgtgtcgctaccaacagtgttggaaca
gcatcttgtagagccaaactcacactacaagaaccaagatatcccccggtctttgataaa
aagctgcagcccgtggaagttttggttggagacagtgtagatcttgaatgtcacatgact
ggatctttaccaataaaagtaacttggtcaaaggatcataaagatattcgtgcagcagga
aactataaaatctcctgtctggaaaactctccacatctcactattttgaaagcagataaa
gcagattccggccagtactcttgccatgcgagtaacgatatcggaaaggactcttgcacc
actcaggtttcagtaaaagagcgcaaaatccccccatcctttacaaaaaagccttcggaa
gtgatggtggatgttgaggggaaggtggtgaagctagaagggcgtgttgctggatctcaa
cctatgagcattagctggtttagagacaactgtgaaatctacagttctgacaatgtggag
atctccttcagaagcaatgtagctgtactgagtataaagaaggctcagctctcggatagt
ggcacttacacctgccaagcaagtaatgaagccggtagtgcctcttatcaggtctctctt
tctatcacagagcaaaagatgcccccaatgtttgatcgcccactcaaagcagtatcagtt
aatgagggtgagagtctgcatctgagctgtcaggttcggggatctccacctctgacgatc
cagtggatgaaggacaggaaagagataacatcatcagctaatatgagaattacctttgtc
gaaggcactgcgactttggaaatcagcgctacttctaaatcagatggtggtgactatctg
tgcaaggtcacaaatgatgccggaagtgaattctccaagtccagggtgaccatcaaagaa
aaagcaggtgtcgcaccagcagctgctgaagccatgccagcacttgcaaaacctgtcaag
aaattggaaaacctgttcttcgttgatgaacctaagagtgttaaagtaactgaaaagggc
acagcgacattctttgctaaagttgggggtgaccccattcccagtgtcaaatggatgaag
ggcaagtggaggcagatcactcatggtggtcgcatcactgttgaacagaagggacaggat
tgtaagctagagatccgagaggtgaccagaacagactctggccagtatagatgtgttgca
ctgaacaaacatggagaaattgaatgcagtactgacttaaaggtagaggaaaagaaagga
gcgactcttcttgagggggatttacgagctaaactgaagaagacaccttccaaacagaag
agtccgaaagaagcccaagaaattgacattgttgctttactgaggaacgtggatccaaaa
gagtatgaaaaatatgctcgtatgtatggaattacagacttccgtggcctccttcaggct
attgaatttataaagaaggagaaggaacatgaaactggacgtgtggaagtagaacgtaga
gaaagagaatcagatgaagatttggccaaactgatgtctgacttgcagcgaagaatggaa
caagctgagcccatcactctggtgaaggacataacagatcaaactacatccaaagataat
gaagcagtgtttgagtgtgagatcaagattaattaccctgagatcagcctttcttggtac
aaagggactcagaagcttgatactaatgaaaagtatgaaatcagagttgtaggtgaccgt
cacatactgaaaatcaaaaactgtcaatcagaagaccaaggaaattatcgtgttgtatgt
ggtccacacatctctggtgccaaattaacagttagagagcgtgaagtggaggaagacata
aaacctgtttctgctgcaaaaatccatttcaccaagagtatccagaatattgtggtgaat
gaacgtcagtcagccacctttgaatgtgaagtctcctttgacaatgctattgttacatgg
tacaaagccacatgggaactcaaagaaagtccaaagtacagctttcgaagtgaaggtcgc
cgtcactttatgatcattcacaacgttacagcggaggatgaaggcatgtattctgttatt
gtgagattggaaccaacgggtgaagctaaaagcactgctgaactttacctttacagcaaa
gaagttgatgtagaaagggctggttttgatattcctgattcatcggtcgatgttcctgag
gtgtcatcagaagtcacctcaaaagttgatacttccactgtttactatgaagagaagatt
gaaatgagagagtttgaaagctggacaatacaagaagaaagagtaatacaggaaatatct
accatacaagctaagatgcctgttgatgaaacagttccaagggctgaaattggaatgaga
gacaaagagccagtaaaagttcctgagccctacataaaacctgaccttggtgctccaact
gtgacagaggccccaacacccactcaagtacctgaggccaggattcctgttcaagaagac
atcccagcagtagttattcctgagcaaagataccatccaatgcctaaagaatatgaagag
gtcaagaagcctgttcctgaggctgctcctattccttccaagatagacaaagatcagatt
acatctaaaaaagatatacctgaaccagcctttgtagctcctgagccaaaacttcatgta
acacgtgaatctgaagctgcagctgtagctgcagctaaagttgaacctgaaccaaagcct
ccacctgcaaagaaagccgaggaacctccctctagagttcctgatgaggttaagagacca
gaacctgggaaaccagagcagctaaaacccaaaccagagccaacaactattgtttcaaag
gaggctgctccagagaaagtaccagaagctcccaagaaaccagaagcagctgcaataaca
ccaataagtattcctaaaaaagaggaagagcccaaggatgtacctcctcaaaagaaagag
gtcactccagaaaaagtccctgttaaagcaaaaacaccagagataccaaaagaagaggca
gctagaaaaccagacttagagacttgtccaccaaaggggatcattccactggaaggtatg
gattctggtcccctatggaaaaacagttattttatagactgtcagtatctaaatttcttc
atgtgtgccttttttcttcagtttttcataaagatttgccttgtatcttctctccttcat
tcattatttcacacctgtcctaaagagaaccctattttcagtgttcaggtggctgttaaa
gagaaggaagcacctgctgagaaagttcttcctgtggtccctaaaaaggagctggaggtg
actcttacgagaggtaggcctgaggccatatctgcttttccagcctggaacatacacctc
agtgatatcttcggttttcattacttgtgtcttttgttcattgttttaatatttccagtt
atgtgtgttttgtgtctaaaactgcagattttaagcaggccatttttcctttttgagcta
aatgtgagctattttaatagtctttcatttcaaaaatacctattaaagccaggtacatta
gtagcaatttccaagaaacctgaacaagttccatctgctgtgattgagaaattggaggag
gtctcttatggcatagaagtgacctcccaaacagaagaatttcatcttcaagaagaagtt
tatgagagtatggagggattctctaaggaaaaagagaaactcagttttgaagatgtttca
catgtttcaagagatgagattgctttgaagagagaggaaatccctaaacccaaagtattc
ctccaaaaaactgaagaagcaccaaaggaagtgctgccttcaaagaaaggtgacacaatc
agtgcagaggctgttacacctcagcaagcattggacgttccaaaggacaaacaagctgca
atgtctgagattcgaaagatgcaggaggtctcatttgtcaaagaagaggcttcttttgaa
gatgccatttctttccaaaaagagatgtatgagagcacagagttgaattataaagaccaa
gagctaaaaagcacaatggatgattcacagaaggtccagcaagctccattttttgaatat
caaaaaatgcacaaagccctatttctcaaagacgaaccttcacctgaagtaggaattgct
gtcaaaaaagaggtctatgagaccacaaaattctcttgtgaggaaaaagagctgaaaagt
acagcctctgttgctgattcaggagagaggtatttgaagagtgataaagctcgaacaatg
aaagtttcaaagaaatttaagcaaactccagtgtctgagactgaagaaaggcgggaggtc
tcctttgataaagagcaggcttctcccgtagcaacagttccactcaaaacagatgtttgt
gagagcacagaattgtcttataaagagaaagaggtgaaaagtagggatgattacacagat
ttacgagagagttctttgaagattgaagacatccctgaaagcatggcaacccccgaaatg
gccgataaagtagtccgaaaaatgttgccttctgaggatgaggaagtagtcagtttgaaa
gctggcactgcaccttttcaagcaatgaaagtttcaaagaagcctaagcaagctccagtg
tctgagattcaagaaaggcaggcagtctcctttgacaaagagcaggcttctcccgtagca
acagttcctcttgcaaaagatattcttgacagcacagaattgtcttataaagagaaagag
atgaaaagtagggatgattacacagatttacgagagagttctttgaagattgaagacatc
cctgaaagcatggcaacccccgaaatggccgataaagtagttcgaaagaagttgccttct
gaggatgaggaagtagtcagtttgaaagctggcattacaccttttcaagcaatgaaagtt
tcaaagaagcctaagcaagctccagtgtctgagattcaagaaaggcaggcagtctccttt
gacaaagagcaggcttctcccgtagcaacagttcctcttgcaaaagatattcttgacagc
acagaattgtcttataaagagaaagagatgaaaagtagggatgattacacagatttacga
gagagttctttgaagattgaagacatccctgaaagcatggcaacccccgaaatggccgat
aaagtagttcgaaagaagttgccttctgaggatgaggaagtagtcagtttgaaagctggc
attacaccttttcaagcaatgaaagtttcaaagaaatttaagcaaactccagtgtctgag
actgaagaaaggcgggaggtctcctttgataaagagcaggcttctcccgtagcaacagtt
ccactcaaaacagatgtttgtgagagcacagaattgtcttataaagagaaagaggtgaaa
agtagggatgattacacagatttacgagagagttctttgaagattgaagacatccctgaa
agcatggcaacccccgacatggccgataaagtagtccgaaaaatgttgccttctgaggat
gaggaagtagtcagtttgaaagctggcactgcaccttttcaagcaatgaaagtttcaaag
aagcctaagcaagctccagtgtctgagattcaagaaaggcaggcagtctcctttgacaaa
gagcaggcttctcccgtagcaacagttcctcttgcaaaagatattcttgacagcacagaa
ttgtcttataaagagaaagagatgaaaagtagggatgattacacagatttacgagagagt
tctttgaagattgaagacatccctgaaagcatggcaacccccgaaatggccgataaagta
gttcgaaagaagttgccttctgaggatgaggaagtagtcagtttgaaagctggcattaca
ccttttcaagcaatgaaagtttcaaagaagcctaagcaagctccagtgtctgagattcaa
gaaaggcaggcagtctcctttgacaaagtgcaggcttctcccgtagcaacagttcctctt
gcaaaagatattcttgacagcacagaattgtcttataaagagaaagaggtgaaaagtagg
gatgattacacagatttacgagagagttctttgaagattgaagacatccctgaaagcatg
gcaacccccgaaatggccgataaagtagtccgaaaaatgttgccttctgaggatgaggaa
gtagtcagtttgaaagctggcactgcaccttttcaagcaacgaaagtttcaaagaagcct
aagcaagctccagtgtctgagattcaagaaaggcaggcagtctcctttgacaaagagcag
gcttctcccgtagcaacagttcctcttgcaaaagatattcttgacagcacagaattgtct
tataaagagaaagagatgaaaagtagggatgattacacagatttacgagagagttctttg
aagattgaagacatccctgaaagcatggcaccctaccaaaaaattgataaagtagttcga
aagaagttgccttctgaggatgaggaagtagtcagtttgaaagctggcactgcacctttt
caagcaatgaaagtttcaaagaaatttaagcaaactccagtgtctgagactgaagaaagg
cgggaggtctcctttgataaagagcaggcttctcccgtagcaacagttccactcaaaaca
gatgtttgtgagagcacagaattgtcttataaagagaaagaggtgaaaagtagggatgat
tacacagatttacgagagagttctttgaagattgaagacatccctgaaagcatggcaacc
cccgacatggccgataaagtagtccgaaaaatgttgccttctgaggatgaggaagtagtc
agtttgaaagctggcactgcaccttttcaagcaatgaaagtttcaaagaagcctaagcaa
gctccagtgtctgagattcaagaaaggcaggcagtctcctttgacaaagagcaggcttct
cccgtagcaacagttcctcttgcaaaagatattcttgacagcacagaattgtcttataaa
gagaaagagatgaaaagtagggatgattacacagatttacgagagagttctttgaagatt
gaagacatccctgaaagcatggcaacccccgaaatggccgataaagtagttcgaaagaag
ttgccttctgaggatgaggaagtagtcagtttgaaagctggcattacaccttttcaagca
atgaaagtttcaaagaagcctaagcaagctccagtgtctgagattcaagaaaggcaggca
gtctcctttgacaaagtgcaggcttctcccgtagcaacagttcctcttgcaaaagatatt
cttgacagcacagaattgtcttataaagagaaagaggtgaaaagtagggatgattacaca
gatttacgagagagttctttgaagattgaagacatccctgaaagcatggcaacccccgaa
atggccgataaagtagtccgaaaaatgttgccttctgaggatgaggaagtagtcagtttg
aaagctggcactgcaccttttcaagcaatgaaagtttcaaagaaatttaagcaaactcca
gtgtctgagactgaagaaaggcgggcagtctcctttgataaagagcaggcttctcccgta
gcaacagttccactcaaaacagatgtttgtgagagcacagaattgtcttataaagagaaa
gaggtgaaaagtagggatgattacacagatttacgagagagttctttgaagattgaagac
atccctgaaagcatggcaacccctgaaatggccgataaagtagtccgaaaaatgttgcct
tctgaggatgaggaagtagtcagtttgaaagctggcactgcaccttttcaagcaatgaaa
gtttcaaagaaatttaagcaaactccagtgtctgagactgaagaaaggcgggaggtctcc
tttgataaagagcaggcttctcccgtagcaacagttcctcttgcaaaagatattcttgac
agcacagaattgtcttataaagagaaagaggtgaaaagtagggatgattacacagattta
cgagagagttctttgaagattgaagacatccctgaaagcatggcaacccccgacatggcc
gataaagtagtccgaaaaatgttgccttctgaggatgaggaagtagtcagtttgaaagct
ggcactgcaccttttcaagcaatgaaagtttcaaagaagcctaagcaagctccagtgtct
gagattcaagaaaggcaggcagtctcctttgacaaagagcaggcttctcccgtagcaaca
gttcctcttgcaaaagatattcttgacagcacagaattgtcttataaagagaaagagatg
aaaagtagggatgattacacagatttacgagagagttctttgaagattgaagacatccct
gaaagcatggcaacccccgaaatggccgataaagtagttcgaaagaagttgccttctgag
gatgaggaagtagtcagtttgaaagctggcattacaccttttcaagcaatgaaagtttca
aagaagcctaagcaagctccagtgtctgagattcaagaaaggcaggcagtctcctttgac
aaagtgcaggcttctcccgtagcaacagttcctcttgcaaaagatattcttgacagcaca
gaattgtcttataaagagaaagaggtgaaaagtagggatgattacacagatttacgagag
agttctttgaagattgaagacatccctgaaagcatggcaacccccgaaatggccgataaa
gtagtccgaaaaatgttgccttctgaggatgaggaagtagtcagtttgaaagctggcact
gcaccttttcaagcaatgaaagtttcaaagaaatttaagcaaactccagtgtctgagact
gaagaaaggcgggaggtctcctttgataaagagcaggcttctcccgtagcaacagttcct
cttgcaaaagatattcttgacagcacagaattgtcttataaagagaaagaggtgaaaagt
agggatgattacacagatttacgagagagttctttgaagattgaagacatccctgaaagc
ttggcaccctaccaagaaattgataaagtagtccgaaaaatgttgccttctgaggatgag
gaagtagtcagtttgaaagctggcattgcacgttttcaagcagtggacattccaaagaaa
gctgaacgagcttcactgtttgacgttcaaacaatgcaggaggtctcattggtgaaaaag
gagacttttggagaggccatttctttccaacaggatgtgtatgagtgcacagagttgtct
tctaaaggcaaaaagcaaagaagtggagaggaatttgctgcttcgagggagaggactttg
gagaggactaaaccagaaaagaagactgtaacccctactccattcgcagaagtgtttcct
ccagaagctgagaagaaagttgtacctgagggaccaaaacctgcacctgctcaacctcca
gaaaaagtgccccaaccagaagagccagaaaagaagactacacctgatgtcatccctctt
tcagtcaaagaaatagttcccccagaaggtgatgccatggaacctgttacagcacctgga
gcagccaaaaaagcttttattgcatcagacaaagaacgtgaaacacgacccattcttaaa
caaaaaagcaaaattcctgtagaagaggaaacttttgaaatgccagttttgaagaaaatg
agcaggaggctaaaaggaaaggacgaagagaaagaaactgttaaactaaaaaagatacct
aaggccccaactgatgaaatgccaggggagccagaaatcactcttcaggaagtgttaagt
tatgaaaaagaggagttgatccattctgaagccattacagaagctacatttacagaaagt
catgaagttttcagaggtggggaaaaggaagtaattgaacaggtacagttgatgaaacct
aagaaatttcccacagaggctgtttttactgatgaaaaagaggtaggtttaaaagaagct
gtcataatacccaaagaagaatcacccaaagaaactagtttgacacttaaaaaagtgtta
agaataccaacaaaagagaaagaacaagaaaaagtggtgctaaaaccaattgaaagacct
gctaagccagaagaagtgttgatgaaagaagttaaaaaagaggtagaaagggaacccttg
gctttcaaaaaaattgagagaccacaaaaagatgaagcagttaaagaacctgctgttcct
cgtgagaaggtggaaatttccttggatgaaaaagaagaggagcccagtgtcagacaagca
gctgataaaacacccaaggataaaaaaccccaggaaccaagtaaacagttaacaagagta
aaaagagttcccacgcatgaacaggaaggggaaaaagtggagctgaaaccattttcaaaa
gttcctaaacctgaattacctgtacaaaaaatcccttcagtgtcaaaagaaaaggaagat
acctcagtcatgaagccagtaaaagctgcaaaggatgaaaaaccagtcgatatgattact
gcaccaaagaaagctgaattgccagcaacactggataaggagccacaaaagtttacaaaa
acagaaagtccccatgaacaagaaatgaagcctgtcactcctaaagaaattcctttaaga
gagaagctgagtccaaaagaagataggaaaccagtaccactaaaaaaagagattttgcca
aaggaacctgatgaaaaagaaatattactaaaacatgttgagaaacctaaacaagatgta
caactgaaaaagactccttctccaaaggtcactttatcaaaactgaaagaacctgaattg
agtcctgtggaaaggaagcccagccttgatgccataaaaaagttacctccaaaaatctct
ccaaaagactccattgaatcaattaccttaaaaaaagtaccaaagaaaccatctcctcct
gaagaaaaaactgttgaaggagctccactgaaaattgggaaaggaaaagtacccgttatg
aaagaaatgtcacctgaaactgtgcagcttaagaagattcctactcaacaagaggaagaa
atttacaaagaaggaccagagagagaagtggaaggtgaggagagttctttggaatgggaa
ctcactcctcgtgagagttatgggtcttcagaagactgggaagaaactgcttcagaggag
ggtgcacttgagactccaggaatgaagggtgacagacgagaaggaaaacccaaagaggaa
ccaggcaaaggcaggggcattagagcaaaacaaaccccttcacctgcagacagtgataag
agaaaaggcttaaaaccgggtactggaggtgaaaaaccaccaggggatgcaccatttgga
ttccagcttaaagctgtccctttgaaatttgtaaaggagttgaaagacattgtgctacaa
gaagctgagtctattggctcttcagcagtctttgagtgtcagatttctccttccaccgct
atcacctcatggatgaaggatggaagcaacttgagggagagtccgaaatacaaatttact
tcagatggaaaggatcgtaaactagcaattattgatgtgcagctgtctgacactggggag
tatacttgtgttgccaagcttggcaacaaagaaaagacttcaactgcaaaactcattgtt
gaagaactgcctgtcagatttacaaagaacttggaggaggaaatttctgtcattaaggga
cagccaatgtatttgacctgtgagctgagcaaagaaagagatgttgtctggaagaaaaat
ggcatacctattcagccaatacctggcaagctggctattaatgtcattggactacagcat
gctgtgacaattcagaactcagaagatgatgatgctggtgtttactcatgcgagtgtgaa
aacatcaagactcaaggaaatgtgaaaatcgttgaaattatcagagactggttggtaaag
ccactgagagatcagcatgtaaaacccaaggccactgctacattcaaaggggagcttttt
aaggacactccaaattggaaatggttcaaaggagatgaagagattcctattgagcccact
gataagactgaagtaaaaaaggatggaaacattctcactctagtcattaagaatgcaact
cctgatgatgttggggaatattccatggaggttgaaggacaacgatactcagctaagcta
actcttggagagcgggaagctcagatcttgaagcctctctcaagtgtggaagtctatgaa
aaagagactgctaactttgaaactgaaatttctgaggaggacattccaggagaatggaaa
cttaaaggccagattttaacaagatcacctacttgtgatatcaaagcagagggaccaaag
agatttctcactctaaaaaacttggaagttgagcagtctggtgaaatctcttatcaagct
ctcaatgccattacaactgcaatgctgacagtcaaagaaattgaaatggacttcactgtt
cctctgaaggatgtgtctgtacctgaaaagaaacaagcgcaatttgagtgtactatcaca
agggatgtccccaaagtgatgtggatgaaagggactgacataatcacaaaaggtagaaaa
tatgacattattgatgatggaaagaagcacatactagtcatcaacgaatgtgaatttgat
gatgaggaccaatacaccattgaagtccaaggcaaaagatcaacagccaaactcactgtg
gaaggtatacggctcaaggtcaccacaccgttaaatgaccaaatagtgaaggaaggtaaa
acagctcggtttgagcttgagctcagtcatgaaaatgtaccggtgacatggtacaaaaat
gaaacaaaattgcatcccagcagaactgtacttacccatgttgatggaaaaaaacatata
ttagaaatcaaagaagtgactctagatgacacctgccagattaaggcagaggccaaagga
attcccacgatggctaaccttacagttatagaggctgacccatactttacagttaaatta
caagattatactgcagttgagaaagatgaggttatccttgactgtgagctaagcaaagat
gttcctgtgaaatggtaccataatgaggcagaagtcaaagcctctaagatggtcagtatg
aaggctgatggcaaacggaggatcctttcaatcaagagagtggataacaaagataaggga
acttatgtttgtgattgtggaacagacaagacagttgcagagattaacattgaagctcgt
gacatcaaggtcatccgccccttgtatggtgtggagctctttgatggagagactgcacgt
tttgaggtggaaatctctgaagatgatgtacatggccagtggaaattgaaaggagaagtt
ctaacgccatctcctgatgttgaaattattcaggatggtgccaagcacatcttgacattg
tacaactgtaaaatccctcagtcaggagaagtggcattccaggctgctaatgccaagtgt
gcagctaatttgaaagtgaaagagcttccacttacctttatcactcccttgagtgatgta
cacgtgtatgagaaggatgaagcaaggtttgaatgtgaagtttctagggaagctaagacc
ttccggtggctaaaaggatctcaggatttgaaaactgatgagaaatttgaaatacttcaa
gagggcagtcgtcatattcttgtggtcaaatctgctgcctatgaggatgaggccaaatac
atgtttgaagcagaagacaaaagaacatctgggaaacttgtaattcaaggaattcgactt
gagttcatcaaacctatcaaagatgtaacagtaaaagaaagggaaacggcagagttcagt
gttgaactgtctcatgacaaggtaccagtcacttggtacaagaatgatgttcgcttgcac
ccaagcaaagttgttcatatgtcagaggatgggaaggttcatactttggcctttaaagaa
gtttccattgacgacacatctctcattaaagctgaagcactggggaaaagttctgaggct
atgcttactgttcttgagggagaaccgtacttcgtcagaaaattgcaagactacactgca
gtagaaaaggatgaagttgtcctgatgtgtgaactgagcaagccttctgccgaagtgaaa
tggttcaaggatggcaaggagatcactccctccaaaaatgtgttcatgaaatcagatgga
aagaagcgcattttaactgtgaagaaggcagagaagggcaacattggggaatatacatgt
gactgtggttctgataagactgctgctaaattaaatattgaggaacgtgatattaaaatc
atccgccctctgtatagtgtggaggtgacagagacagagtctgctcgctttgagacagag
atctctgaagaggatgtccatggtcactggaaacttaaaggagatgcacttcaccagtct
cctgactgtgagattaaagaagagggcaccaagcacattcttatcctgtacaacgtgctc
atgagccaggctggtggtgtagatttccaggcagccaatgctaaatccagtgctcagctc
agagttaaagctcgggtcattggtctgctgcgaccactcaaagatgttacagttactgct
ggggagactgccacatttgagtgtgaactgtcttatgaaggaatcgttgtagactggtac
ttaggaaatacaaagctggaaccaagtgatagaattgtcacacgtgctgaaggcagagtt
cacaccctgaccgttagagatgtaaagcttaatgaggctggagaagtcaaactaacagct
aaggacttccttactcaggccaggctcattgttaatgaaccaccagttgaattcacaaag
cctctggaagatcaaactgttgaggaggaggctactgccaccttggaatgtgaagtgtct
agggaaaaagctgaggtgaaatggttcagagatggacaagaaatccgcaaaactaagaag
tatgatattgttgctgatggacggaagagaaagctcataattcaaggctgtactcttgat
gattctaaaacttacacctgcgatgccaaagatttcaagacgtctgccttcctgaacgtt
gagccgctgcgtgttgaattcaccaagccactccatgatgttgaagtcaaagagaaggat
tcggccagatttgaatgtgaagtttctcgtgagaatgcaaaggttcaatggttcaaagat
ggcagtgaaattagaaaaggcaaaaaatatgacattattgccaagggggttcagcgcatt
cttattatcaacaaatcagtctttgaagacgaagctgaatatgaatgtgatgccaggact
gcaaaaacctctggaatgcttactgttattgaggaagaggctgtgtttacaaagaatctg
tccaatgttgagggtaccgaaactgacagtattaagatgatctgtgaggtgtcaaagccc
agtgcagaagtgagatggttcaaaggtgaccaagagctgcctgaggggggcagatttgaa
cagattcaagatggcagaaagaggatacttattatccgggaccttcgtatggatgacgtt
ggagagtacaattgccgattaccaagttcacaaacctcagcgacactgaggattaatgaa
aaggcagccgaattcattaccaggcctcagagccaagaagtggtcgaaggtgaaaaggca
gagtttgtttgctcagtttccaaggacacttacgaagttaaatggattaaggacgacaag
gaactcgaaatcggagacaaatatgatattgtttgtgatggcaagagaagagcacttatt
gttaaggattgtttgctaaaagatgagggtccctatgttgccctcattggctcttcaaga
gctactgcagatctttttgtgattgaaaagctaaggattattacacctatcaaagacacc
caagcaaaggagggtcaagaaattgtcttcaactgtgaggtgaatactgagggtgctaaa
gctaagtggctgaaaaatgatgagacaatgtttgagactggcagatttgttatgacccag
aaagataatgtgttttctctgagaatcaaagatgctcagatgtcagatgaagctaattac
acagtcactctaacaaatcaccgtggagaacatgccaaaagctctgctacactcagtata
caagaggaagaccttaggatcattgagccccttgaggactgtgagaccttggagaaaagg
actgtgaccttctcttgcaaagttaacaaacccaatgtgacagtaaaatggatgaaagga
ggacaagagattacttttgacaaacgaattttgtacaaagtggacaaaaacaaacacaca
ttgactattaaggactgcagtctggcagatgaggcagagtattcggttgttgctggttct
gacaaatctacagctgaactcatcatcagcgaggccccaactgacttcttaacccagcta
atggaccagaccatcactgagtttgaggatgctgagttctcctgccagatctctaaggaa
agatcagaagtcaaatggtacaaaaatggtcgtgagatcagagaaggacccaggtaccgc
tttgagaaagagggcaatacctgcagattgcacattaaggagtgtagaccggatgatgaa
tgtgaatacgcctgtggtgttgatgacagacgttcaagggctaggctctttgttgaagaa
atcccagttgaaataatcaaaccccccagagatatatttgatcctcctggttcagatgtt
gtgttcgaggctgagctcaacaaggacagagttgaggtgaaatggttaagaaacaacatg
accgttgtccagggtgataaataccagatgatgagtgagggcaaggttcacagactccag
gtttgtgagatcaggcctcgtgatcagggtgaatatagaatcattgccaaagataaggat
gccacagccaagctggaattagcagctgtaccaaagttcaagacaacagatcagaacctt
gtgactgatgctggaaagccttttgtcatgacagttccttatgatgcctatccccatgct
gaggctgagtggttttttaatgatgttagcctaccaaggaaaaattttgacacttcagct
gaccagacagagtacagattgaaggatccaaagaagtctgaccaaggtcgatacaaaatt
gtcattcagaacaaacatggaaaagcagaagcttttattaacctggaagtcattgatgtt
cctggacctgtgaaaaatctcagtgtggtggacactgctgatggtgaggtcagccttgcc
tgggatgagcctgagattgatggtggtagcaaaatcatagcctatgttgtggagaggcgt
gatgtcaagcgcaagacttggaccatggctacagaccatgcagaaggcacagagtattgt
gtaactgggctgcacagggactctatgtacttcttccgtgtttgtgctcgcaacagagta
ggaagtggccctaatgtggagacagacaaacctgtccaggccaagaacaagtttgatgtt
cctgaggcaccacagaatgtcatggttggaaacgtgaacaaatttggtgccactctatcc
tgggaaccccctgagtatgatggaggatcagaaattacagcttacattattgaactccgt
gacagaacctctgttagatgggaaccagctcttgtcaccaaaccagaggaccggacagtt
gtaatcaatgatgttgtagaggacaaggagtatatcttccgcgtaagagctgaaaataag
gctggaattggcaagccaagtgttgctactgatccagtgaagatcatggatcccattgaa
agaccaagtccaccactgaactttgactactctgatcagacaaagatctctgtcctgctg
acatgggacacacccttgagcaatggaggtagcccaatcactggctacattattgaaaag
tgtgaggatggaaccgacaagtggctcagatgtaacgccaggctttgccaggacttgtgc
tacaaggtgaccggcctaaaacatgagcagaaatatcactacagagtatcagctgaaaat
gcagctggtgtttcagacccagccgaacagattggacctctcacagcagatgatctacat
gttgcccctactatggacctcagtgcattcagggatgggctggaggtgatcgttcctcac
cctctcactatccgcataccaatcaccggataccccctgcctactgcacactggagtgtt
gcagacaaggatttggttgctggagatagggtctccatggttactaaaaacaccttcacc
gagttagtcattactcccagtgtccgcccagacaagggtatctacactatacaccttgag
aatgatgtatccactgtctcaggagagattgatgtcaacatcattgcatgtccaagtgca
cccagagacttcaaggttgcagaggtgacaaggcaccatgtacatcttatgtgggaagcg
ccagaacatgatggaggaagcccacttactggctaccagattgaaaagcgtgaagcatct
cgcaaaacatgggttaaggttatcagtggcatacaggaccaagagtataccatcacagat
gtcattgaaggcaaggagtatctgtttagagttattgcctgcaataagtgtggcccagga
gagccagcatacatcgaggaaccagtcaatgtgtcctccccagcaactgtgccggaccca
ccagagaatctgaaatggagagacaaatctgcaaatggaatcttcctctcatgggagccc
ccaaagtatgatggtggctctgtaatcaagggttacattgttgacaagtgccagcgtggc
actgacaaatgggagccctgtggagatcctgtgccagaactaaaattacaagtgactggc
ctcactgagggacagtggtatgcatatcgtgtcagagcattgaacagacttggtgctagc
aaaccttgcagggctacagatgaaatactggctgtagatcctaaagaacccccagagatt
atgctagatgtaaagctgctcgcaggcttgactgccaaggctggaaccaaaattgagctt
cctgcagatgttctcggaaaaccagaaccaaaagtcacctggaccaaggctgaccttgtt
ttaaaagccgatgatagagtgtcaattgagactaagcctggtcattccacagtgtctata
gcgaaaacgaaaagagacgacacaggcacttacatcattgaggctgttaacagcagcggc
cgagctactgcaactgttgacgttaatattcttgacaaaccaggccctccagctgctttt
gatatctctgatatcaccaatgagtcctgtttcctggcctggaaccttcccagagatgat
ggtggctcaaaagttaccaactacattgttgaaagaaaagccacagacagccaagtctgg
cataagctttcatccacagtgaagcaaaccactttcaaggccaccaatctcgtggctctg
aaggaatatgtcttcagagtgtttgcagagaaccagtatggaattggccccccagcagaa
catgtacccattgttgccaagtactcttttgaccctcctggtgcaccaactaaattgcaa
gcttctgatattgcaaaggactctttaacactgacatggaatgaacctgaagaagatggt
ggtagccccattagtggatactggattgaaagacatgatccagacaatgatagatggatc
agatgcaacaagctgccaattacagatactacattcagagtgaaaggattgccaactaag
aagaagtacaaattccgtgtcatagctgagaatcttgctggacctggaaaaccaagcaag
gaaactgacccagttttggttaaagatccaattgaccctccttggccacctggcaaacct
aaggttaaggatgtggcaaaaacatctgcgttcctgcaatggaccaagcctgagcatgat
ggtggggctaaaattgagtcttatagcattgagctgctgaaaagtggaactgaagactgg
gtgcgtgtggctgatggtgtgcccatgcttgagcacttcctgaagggtctgatggagaag
caggaatattccttcagagtcagagctgtaaacagtgctggagaaagtgaaccaagtgac
cccagtgatccagtcctctgcaaagagagactcaatcctccatcacccccacgttggctc
agtgtggtcagtgtcactaagtctaatgctgagcttaagtggacagcaccagagagagat
ggtggctcccccatcactaactacattgtagagaaaagagatgtgaggcgcaagggttgg
caggctgtggacactacagtgaaggaaactaaatatactgttactcctctgaatgaaggc
tctctgtatgtattccgtgtggcagctgagaatgctgttggccagagtgatttctgtgaa
ctagaggactctgtcttggccaaggacacattcactactcctggaccaccttatgctttg
aatgtggtggaaattacaaagacacatgttgatctgaaatgggaagctcctaagaatgat
ggcggtagacctatcacaagatatgtaatagagaagaaagagaagcttggaactcgatgg
gtgaagtctgcaaagacatcaggacctgactgtcagtatagagtcacagatgtaattgaa
ggaactgaggtgcagttccaagttcgggctgaaaatgaagctggtgttggacatccaagt
gaacctacagatattattacaattgaagatccaacaagtccaccatcaccacccctggaa
ctgcatatcactgatgccagtagagatcaaatttctatagcttggaagccaccagagaac
aatgggggaagtcctataattggttatcacattgaactctgtgaagctggaactgagaag
tggatgagagtcaactctcgtcctgttaaagagcttaaatacaaggcagaagaaggcacc
atcccagagaaagagtacatctttagagttcgtgcagtcaattccgttggagtcagcgaa
ccttctgatatatccgagaatgtctttgcaaaggattctgactgcaaccctacactagag
gtacagactcaagacattgtcgtggtggaaggagagaaactgcaactacccattccattc
agagcagtaccacagccaaaagtgtcttggcacaaagatggaaaggaacttaaggctgat
gaaaggcttactttctcatctgaatacacttttgccaacttagaaattacaagctgtttg
cataatgatgctggtgtatacactattacactagaaaacaagcttggatcaacaactgga
acaattcatctgaaagttattggtcttcctggaccatgcaaggatattgttgccagtgat
gtcacaaagaattcatgcaaagtttcttgggaacctccagacagcgatggtggcagtcct
attctccattatgttctgcagcgtagagaagctggcaggcgcacctatgttgcagttatg
tcaggagagaataaactaagctggccagtcaaagaccttattcctaatggagagtactat
ttccgtgttaaggctgtaaataaaattggaggtggagagtatgtggagatccgaaaccct
gtgattgcggaagatcaaaagcaacgaccggatccaccagttgatgttgaaacccacaat
cctacttcaaattctctaacactaacatggaaacctccaatgtatgatggtggttgcaaa
atcatgggctacattctagagaaggcaattaagggtgaagagaagtttgagagatgcaac
gacttccttgtacctgtactttcctacactgtaaagggcctgaaagaaggcaaagaatat
cagttccgcgttcgtgctgagaatgctgctggagttagtgatccttctcgcagcacacca
ttgataaaggctgcagatgctgttgatccacctaaagtttttctgagcggaaatctacag
tctggtctaactgtcaagagaggtgaagaaatcaggttagatgcctacatatctggatct
ccatatccaactgtaacatgtaggaagggtgaatcccgtgctgttgtacgtgattctatc
agaagtgatcatggagtcttcatgattagggtggagaatgatcacggcattgcatctgca
acttgcgaagttaatgtgcttgatgtacctggacctccggttaatttggtttttgaagaa
ataagaaacacctcagtcatctgcaagtgggacccaccagtagatgatggtggcagtgaa
atcctgaactacatcttggagataaaagataattcaaaggctgaaattggatggattact
gtgacatcaactctcagacgatgtacatatcatgtaaccaaactgattgaaggaaagcag
tatctattccgtatcactgctgagaacaggtttggtcctggagccccatgtgtgtctaca
ccagttgttgcaaagaatccatttgacccacctgaagccccagaaaagcctgaaattgag
gacatcactgctaacagtatgcttgttacttggactgagccaaaagataacggcagtccc
attgtaggctactgggttgaaaggcgtgaaattaacagtacgcactgggccagagtaaac
cgcaacttgatcaatgcccttgaagtaaatgttgaaggtctgctggaaggtttaacatac
atcttcagagtatgtgctgaaaatgcagctggacctggaaagttcagcattccatctgat
cctaaaacagcacaagaacctatcttgcctcctggaccaccaatcccaagaattgttgac
accagcagttgttctattggagtggcctgggatcctcctaagtacaacggaggtggagac
atcctagggtaccatgttgacaaagtcctagcaggaacaaatgactggtcccgctgcaca
gagaggccatggaaaagctgcgagttcacagtatatggagttcgagaaggtgcaaaatat
gctgtccgtgtcatagctgtcaatgctgcaggtgaaggaccccctggcattactgaacct
gttacagtgaaggatccacaagagcttccagttgttgagcttgatctttcagtaaagaat
ggtgttaccataagagctggggagacactgaccgtgcctgcacatgtaactggtagacct
ccaccatatgtgaaatggacaaaagatgacagtgcacctaacaaagagcgtgttgttact
gaaagtgtggggaatgatcatgttcttactgtaaaaaatataacgagaaaggatgagggc
aagtaccagattattgcctcaaacagcagtggaaccaaatcggcttggacaagagtggaa
gtttttgatgttcctggccctgtgcttgatttgaaacctgttgttgtcacaagaaagctg
atgatgctaaactggtcagaccctgaagatgatggtggaagtgatctcactggcttcatt
gtagaaagaaaagattcaaagatgcacacatggagacaacctatagagacaataccatct
aaatgtgagattgtaggtatccttgaaggccaggaatacaccttccgtattgtggcgaag
aacaagtatggctgtggccctgcagtcgaattgggcccaatccttgcagtggatccgaaa
ggtcctccaacttccccagagagattccattatattgaacggaccaaatcctctattact
cttacctggagaccaccccgtaatgatggaggcagtccaattcttggatactttgttgaa
aaaaagaggcaaaatgaagctgcgtttgtggttgccaacaaagatatttgcacggatcac
acattgactgtggagaatctctcagagcttcacatgtatgaattccgcgtgaaggcggtc
aatgaaattggggaaagcgatccttccattccattgactgtagtaattcaagatgatgaa
gtggccccaattgtgaccttactcaagcacttcaaaggggatgaaatcattgtgaagaaa
ggagaggccattgaaattcctgctgaggtgacaggtcttccaatgccaaagatagagtgg
ttgaagaatgaaattgttatttcaaaatcaactaaaacccttataattgaaacggcggag
gtacacagaaccaaatcagataccaagcttaccatccctgaaacaatcaggcaggacaaa
ggctgttacacactgactgcttcaaaccgtcttggatcagctagtcattctatcacggtt
gaagtgcttgaccgtccattaccacctcgaaatattgtgatatctaatatcaaagctgag
tcttgctatcttaattggaatgctccagaagatgatggagggagtgagcttacaaactac
attgttgagaagaaagacacacgcagtgaaaaggcagagtgggaagaagttaataatgct
gtaattgacaggagatatggggtgtggaatctggaaaccaatggcacttacaagttcaga
atcaaagctcagaatagatatggtattagtgatagctgtgaatcagaagaagtcgtcatt
aaggatccttttggactccctgggccaccaggaaagccagttattgtcgaccacaacaag
gacgccatgctagttacttgggaacctcccttggacaatgggggatccacaattacaggc
tactggattgaaaagagagaaaaaggagcatcttactgggctcgtgtgagcagagctgct
gtcacaaaacgtggtttgaagggttgggaattcagtgttcctcgtcttattgagggtgct
gagtaccagttccgtgtgatggcttgcaatgctgctggcgttggtcccccaagtgatccc
tctgatcctgcacttgccattgaacctctttatcctcctggtatgccgtctaccccagaa
gttacagggaaaacaaagaatagtgttactctttcctggaatccaccagaaaaagatggt
ggtagcccaatcaaggggtacattattgagcttcaaggtgagggcacatctgagtggacc
agagtgaatgagccagatgcactgcatccaaccactgagttcactgttccgaatcttcct
gagttgaagaggtaccgcttcagagttattgcagtcaatgctgttggggagtctgagcca
agcccgtcaaccgcagaagttcttgtcaaggagcttcaagtggagcctaaaatctttgtt
gacgtcaattctcttgagttattgtcctgtcgggctggtactactattagaatacctgca
gtaattgaggggcgccctactccaaaggttacttgggaatttgaagggggggcaaaaaca
gaaacgaaagatcgacttcatgtacttcctgtggactcagagattcagtcaactgacaca
acttcaaccatcacaatcaatgactgcaaacgaaaccattcaggcagatacactatcaca
gccaaaaacaaagctggacagaaagttgttaatgtcagagtaaatgtacttgatgtacca
ggacctccaaaagagcttaaagtcgcagacattacacgaaacacatgtagacttacatgg
aagctacctgataatgatggtggtgagaggatcaagagttactttattgaaaagaaagct
gttggaagccacgcttggacaaaagttaacccagcttgtgccagtcaggcttttgtggtc
cctgaccttcttgagggtgaggagtatttgttccgtgtccgggcagagaatcgctttggc
atggggccacatgctgagaccactgaacctgtaaaggccagagatcccatttatcctcct
gatcctcctacaagagtcaagattaacttggtgaccaagaacacagtaactttgacatgg
gcccccccaaagaataatggtggtgctccagtgaaacactacatcattgagcgtctgagc
tgggacacaagtggagcagaaaaggagacctggaaacagtgcaataagcgtgatgttgaa
gagaccacgttccaggttgaagacctcaaagaaggtggagagtatgagttccgtgttaag
gctgtgaatgaggctggtgcaagcagaccctctgctactgctggaccaattgtcgtgaaa
gaccagacatgtgcccctaccattgacctcaaagagctgatggaaggtgaagagggaact
gatatcagcattgttgctaaaattaaaggttgtccattccccacccttacttggcagaag
gccccaattaataagcctgatgacaaggcagaagttcagtatgatcagcatgtcaataag
cttgtatctgatgatcgctgcactctattaataaagcagtccaagagagacgatactggc
ctgtataaaattacagcttccaacacctttggcaaggcatccaaggaaataagactcagt
gttctaggatgtcctggaccacctgttggacctgttaaatttgaggaaatctttgcggag
agagttactttgtcctggcttcctcctaaagatgatggtggctcgaagattactaattat
gtaattgagaaacgtgaggacaaccggaagacctgggtgcatgtctcaagtgacccaaaa
gaatgtgtatacacagtacaaagactgacagaaggtcatgaatatgaatttcgtatcatg
gcgcaaaacaaatatggagttggaccccctcttaacagtgaacatgagaaagccagaaat
cttttcactgttcctggtcagtgtgataagccaaccatcacagatgtaacctctgactcc
atgacagtcaattgggaagaaccagaatatgatggtgggtctatggtcactggatattgg
ctagaacgcaaagaaacaacatctaagcgctggaccagagtgaatcgagaccccatcaaa
atcatgccccttggggtttcatatactgcaactggtctcattgaaggatctctgtaccag
ttcagagtgattgccataaatgcagcaggatgcgggctaccaagtttaccatcagatcct
gtctgtgccagagaccctatcactcctcctggacctccaacccccaaggtcactgactgg
tcaaagtcaacagtggatgtggagtggattcctccactgaatgatggtggatcaaagatt
actggatacattattgagtataaagaagaggggaaagaagaatggaaaaaggctaaagac
aaggaagtaagaggaacaaaatttgtagtttctggattgaaagaacttggcctttacaga
tttagagtaagagcaataaatgctgcaggtgttggtgaacctggtgttgtctcagaagtc
attgaagtcaaagataggacaattgctccagagatagacctggatgctactgtgaaagag
aagattgttgttcatgctggtggtgtaattcgcatcatagcatatgtgtcaggcaaacca
ccaccacagatcacatggaatagagacgatagtgcattaccagaggaagctgtaattgag
acgactgccattagttctgctttagtaatcaagaactgtaaaagaaaacatcaagggatt
tatactctgattgttaagaatgaaggaggtgaacgaagaaaagccattattgtggaagta
ctagatgtccctggtccagttcgtacaccatttgttggggaaaatcttaccaatgactcc
tgcaaattaacatggtactcacctgaagatgatggtggctcagccatcactaactatatt
attgagaaacgtgaagcagatcgaaggggttggactgctgtatcttacactgttacaaga
cacagtgctgttgtgcagggtctacatgagggaaaagcctatttcttcagaattgctgct
gaaaatatcattggaatgggtccatttattgagacgactgcacaagtattgatcaaggat
cctatttctgtacctgaacgacctgaagatctcaaagtcacatcagtaaagaaggactca
atcagcgtaacttggagaccacctaagtatgatggaggctctgagattaccatgtacatt
cttgaggctcgtcttatgggaaaggacagttttacccgcctctcaaatgagaagctgatg
gataggaaatacacctatgaaggtcttaaagagggtgacagctatgaatttcgagttagt
gcagtaaatgaaattggtcaaggcaagccctctttctgcactaaaccagttacttgcaag
gctgaacttgaacctccaaccattgatttggatttccgtgacaaggtacttgttcgtgtt
ggagagacttgcactctccaaggtcgctatacagggaaaccaacaccaaccgttgtatgg
tgtaaagatgatgaagagctaaaagaagatgaccatatcttattcagaaatacaagttca
acattatgcctgaacataatcaatgctaaacgtgaatacagtggaagatactctgtggtt
gtggagaacagcaatggttcttgtaaaggcatttgcaatgttattgttgttgaccggcca
cagcctccagtgggtccagttgtctttgaggaagttttcagaaattatatggtaatttct
tggaagcctcctcttgatgatggtggctctgccatttctaactacattgttgagaagagg
gacagtaacagggatctttggatgccagtgacctctacttgtacaaggacaacatgcaaa
gttcccaaactaattgaaggaagggagtacatcattagaatttgtgctcaaaatatgtat
ggcattagtgacccactgctttctcaggaaatgaaagctaaagatatatacaaagtgcca
gaagcccctaaacaacctgttgtgaaggaggtatacaaagattctgctcttttgacctgg
gaacaacctcgtgatggtggcaagcccattactaactacattgtggaaaagaaggagacc
atgtcaaataggtggtcacgtgcagtaaaagatcgtatataccctgagactgagtactgg
gtaccagaccttctgaaaggatgtgaatacgaattccgtgtcatggcagaaaatgaaatt
ggtgttggtgaccctagtcctccatccaaacctgtttttgccagagatcctgttgtgata
ccaggtcctccagtcctactagaagctgttgacaaaacaaagaattcagtgacattgtcc
tggcagccgccacattatgatggaaggggaaaaatacttggctatcttattgagtatcag
aaagctggtcaggaggaatggataaaggccaatcaaacacctgactcatgtcaggagaca
aagttcaaagtcatcagcctagcagatggtgaattgtacagattcagggttatggcagtg
aattctgctggtgtatctgaacccgcatatgtcccggagccagtgagagcacaggacaga
cttgaacctccagaactcttgcttgatgctaatatgactcgtgaagtccgtgccatggcc
ggaacccatatcgtccttcgtgctggaataaagggaatgcctttccctaaggttacatgg
aagaagaatgacgcagatgttcctcccagagctgatattaaggtcacgggtgtgggaact
aaactggaaatgcgctattgtgtccgttctgacagtggtgattacacactaactgtggaa
aatccagctgggtcaaagacagccacgtgcacagtgctggtcttagataaacctggtcca
ccccacagtctgaaaatttctgatgttagaagtgattcagcttatctgtcatggaaggac
ccagaagataatggaggagctcgaattaccaactttgttgttgaaaagaaagatattgca
tctgcacagtgggtgcctgtctgctcttcatctaaaaagcgtagcattacagttaagcat
ttaatggagggaactcagtatatgttccgtgttgctgccgaaaaccagtttggcagaagt
gaatatgtgggaacaacaaaacctattaaggctatgaatcctttgttcccccctgggcca
ccaaaaaatttacatcatgtcgatgctgacaaaactgaagtttggcttcagtggaactgg
ccagatcgcacaggaggtagcgatattactggtttcttagttgaataccaagaagagggt
gaaaaagactggattaccttcaagactgttagcattcctgaaagccacgtgactggactt
caggagggaaaaacatacagattccgtgtcaaggcagagaatgccgttggtctgagtcgt
ccggataccactgtaccagttctttgccaagagaaacttgtgccaccgattgttgaagtc
gatgtgaagctaattgaaggtatcattgtgaaagctgggagcacaatcaggctgcctgca
ataatgagaggaattcccataccaactgctaaatgggtcattgatggtacagagataaaa
agtgaaggcaaagtgaagattgacactgacaactattcaactgtattaagcatcaatgat
tgcaccagaaatgacagtggagtttaccttcttacagtctcaaatgctgctggaagcaag
acggttgctttgaatgtaacagttcttgatgtcccagcaccccccattggcccagtcaag
atacttgaagttgctcctgagtacatgatcattgaatggcgcccccctaaagatgatggt
ggaagtccagtaatgaattacattgttgaaaaaagagaatctagcaaagaaacatgggga
ggagtgagttctggtagcactagtacaaaagttaagattccacgtctgcaaaagggctcc
gaatacattatacgtattcgcgcagagaacaagattggtattggtgctccacttgaaagt
gccccaacagttgctcagcatatgtttgagcctcctggacatccaggcaaaccaaatgtt
tctgaagttacagaaaatgctgtaacagttggttggactatgccattgtttgacggtgga
agtcctattagtggatacattattgaacggagacaccaggctggcaaatggattcgtgtg
aacaagacaccagtacaggatctcagatacagagttcttgggctttttgaaggaaacaat
tatgaatttagagtttttgcagaaaacattgctggcttcagtggaccttctccagtgtca
gacccagttaaaccttctcgtccagtcactgttcctggacccccagtgaaccccaagcta
aaggactggagcaagtcctacgcagacttagtgtggactaagcctacaagagatggaggc
agcccaattttaggatacattgttgaatatcaaaagtcaggtagtactgaatgggaaaga
ataaataaggatgatcttatcaaacagtgtgcatttagagtaccaggactgactgaaggc
tcagaatacagattccgaattagagcttcaaatatgattggagatggtgagccaagagag
cttccagaatcagttgttgctaaagatattcttgtccctccagagattgatattacttca
catgaccgattaactgtcagagtagggcataatattaatcttgttgcttatgttaaagca
agacctgatcccgagattacttggatcaaggatcaaaaggttatagaaaaagacaaacgt
acagcaataaatctcaattttccgcttgtccatatgttcatcaaagaagcaacaagagca
gatcatggaaagtatatcattaaagcaacaaatgacagtggtgaggcgcaagccactatt
acagtgaatgtacttgataggcctggacactgtcagggtctgaaggtgacttatgtgaca
aaagattcttgtatgatatcttgggaaaatccagaagacaatggaggcactgaaattaca
aattatatcattgagtgccgtgaacctagccaaagggcttggtcaatgatttcctctgat
tgtaccaatcgtgttgtcaaagcaaaactcatggaacatcatgaatatttcttccgtgtt
tgtgcagagaacaaatgtggtcctggacccacaactgaaactaaaacaccaatccttgct
attgatccagttgcgaaacctggtgaaccagagaatttccatgtaactgatattggcaag
aattttgtctctctcagatggagaaaaccagattatgatggtggcagcccaaatcttgcc
tatcatgtagaaaggaaagcaaaagatgctcaggagtgggagaggcttcataagggtgct
attaaagaaacatactttatggctgacaaatgtgctgaaaaccaaatatatcagtttaga
gtacaaacagtgaatgagggaggagaaagtaactgggtgaagacaggggaaattcttgtc
aaggaagaagtacaaaaaccagtacttgatatcaagttagctggtgtgcttgtagtaaaa
gctggtgaatcaatcagaattgaagctggcctcagaggaaaaccacagcctgaggttaaa
tgggtgaaagacaaagatacaggggatttcaacaaaagcccaagacttcacattgaaact
ggttctgattactctaagttcctcttgactaagtccaaacgagaagactctggaaagtat
gtaataactgcaacaaactcagcaggaacctttaccgcatatgccacagtgaatgtgctt
gatgtgccaggtcctgttagagacctgaaagtatctggaatttcagtggacaggtgtaga
gtggtgtgggatcccccagaagatgatggtggttgtgaagttcagagctacattttggaa
aagtgtgagacaagaagaatggtgtggtctacttactcttcatctgtcatcaatagttat
gccaatgtgactcgtcttgtggagggaaatgaatacgtcttcagagtacgagcagaaaac
aagatgggaacaggtcctgcaatggaaagtaagcctatcattgccagaactcagttcaac
agacctggtccacctgatccaccagaggtcactaaaattggcaaggaggaaatgactgtt
gtatgggcacctcctaaacatgatggaggaaaatccattactgggtatattcttgaaagg
aaagagaaacgtgctgtcagatgggttgcagttactaagagtcctatcccagaaaggcgg
atgaaagttactaacttaattcctaatcatgagtatcaattccgtgtcaaagctgaaaat
gaagttggattgggagaacctagcaaaccttcaaaacccattgttgcaaaagatccaata
gaacctcctggtcctcctggaagtttgaaggtggttgacagcaccaagacctcagtcaca
cttggctggacaaagccagtgtacgatggaggtgctcccataattggatatttggtggaa
atgagactgaaggtagaaggtgataaacaagaagaaacctggaagaaatgcaatatcagc
acacagctcgtactgaccgaatttaccattactgacttggatgagaagcaggaatatgaa
ttccgagtttctgcacaaaatcaggttgggatgggtcgtcctgcaaatcttaaggatgct
gtgtcacctaaagaaatacttgaagcaccagagattgatttggatgccagtctcagaaag
ggtctcactgttagagcaggttgccctatcagactctgtgctacaatcagaggaagacct
tcacccaaagtaacatggaaaagaactggtgttgataacgttgtaagaaagggtcatgta
gatcaaattgacactatgacatttctcgtcatccctgaaagcacacgagaagactctgga
aagtattctctgacactttccagccctgctggggaaaaggctgtatttgtacatgttaaa
gtactagatactcctggacctgtgggagggcttgaagcttcgaatatcactaagacctcc
tgtcagctttcgtggtctcctcctgagaatgatgggggtagtccaatattaaactatata
gttgaaaaacgtgaagttgacagaaagacttgggcaaatgtgatcaacgatttgaagaag
acaagttttaaaatcactaatcttgcacctgttactgaatactattttagagtcacagca
gtcaacaagtatggtactggtgttccaaaagactctccgaaatcatatctggcaactgat
cccatcactgaaccggatccaccaaagaaggtggacattctagagattacaaaaaatagt
gcagtgcttgggtgggtaaaacctctgagagatggtggagctaaaatcaatggatatgtg
gttgattaccaggaggagggtcaacctgaggacaaatggacaccatactctgttgtcaaa
gatttaagcattgttgttgttgggctaaaggaaggcaagaaatataaattcagagtggct
gcaagaaatccagtaggttccagtctgccaagagaagctgagggaatgtttgagatcaaa
gagcagctgttggcaccaaagatccttatgactgatgttgtgacagtaaaagctggatca
aaactgagagtggaagctgttgtgtctggaaagccagctccatcttgtaaatggaaacga
ggaagcgaggatgttgtgacatctaatcgcatttttgtggaaaaatctttgaattgttgt
gctcttatgatcaaagatgtctcaagaaaggacagtggttattacagtctttcagctgaa
aacagtacagcaaaagtggatcaaatattgcgggttattgttatggacatccctggccca
ccagagccaccatttgaaattactgaggcagacattgatggctgcacgctcagttggcac
acaccacgtgaagatggtggaagcaacataactaactatgtggttgagaaatgtgatgtg
agccatggagattgggtcactgctgttacctcctgcaccagcactaactgtagagtgggg
aaactaacacctggaaaagagtattacttccgtgtccgtgctgagaaccgctttggaatc
tcagaaccaactgtgtctgggaagatgactgcaagatacccatttgatgtgcctggtgaa
ccaaggaattgtcatgtctccaaagtcttcaaggacagcatgttggtagcctgggaaaga
ccagtaactgatggtggaagtccaatcactggatactgtattgagcgcaaagagagaaac
agcattctttgggttaaggccaatgaatcaattgtgcgtaacacagaatactcatgttct
ggcctcattgaaggtctagaatatactttcagagtatctgcttttaaccgtgctggacag
ggaaaaccaagcaaacagacagaatttttcacagcaagaacaccagttgatccaccaggg
aaaccagaagtcattgatgttaccaaaaattctgtttctctggtgtggagccaaccaaag
catgatggtggcagtcggattataggatattatgttgaagctctaaagcttcctggagat
aaatgggtacgctgcaacacaagcagccaaagcgtacccagagaagaatatattgcaacg
ggactggaagaacatgcccagtatcagttcagagtcattgctaagactgcaataaacctc
agtttaccatctgaactttctgacccggtcactgtgattgcagaaaatgtcccaccaaga
atagagattggacttcatatgaagaacctcataatagttaaggctggagcaaatgtttgt
cttgaggcagaagtgtttggaaaaccaatgccaaaggttacatggaagagggatggtcaa
ccactgaaacttgctgaggggatgaaattttcacagaagagacatcttttcctcttggaa
ttgttctccgtgacaagaaaggaaacgggagaatacactattctggcagaaaatgcaagt
ggctccaaatctgggaacattaagctgaaggttctggataaacctgggcctccagcatct
ataaagattgtcagtgtgtatgcagattgtgtcaagatgaggtgggaaccacctcttgca
gatggaggttcagaaatcaccaactacattgtagataaacgtgaaacaagtagagcaaac
tgggctcaggtgaccgctaatataagtggccagctcactgactgctctgtagagagacta
attgaaggccatgagtatcagttccgtgtcagcgctgaaaacaagtacggaattggagat
cccatcctgactgatcccatttttgctaagaatccttacgatgttcctgggccttgtgat
cctcctgttattaccaatattactaaagatcatatgacagttagctggaaggcacctgct
gatgatggacaatccaccatcctcggatacatggttgaaaaacgtgaaacccaagatgtt
aactgggttaaagtcaacagaaaaccagtgatagacagaactattaaagctggaggtctt
aatgagggagctgagtatgaatttagagttattgccttcaacaaagctggtttgggcaag
ccaagtgatccatctagtgctgcttatgcacttgatcctctgtaccctcctgccccacca
gctttcccaaaagtagttgacacaacacacagctcagttagtctgtcctggacaaagcca
gcctatgatggtggctgcgaaatcttgggttacctagttgagtgcaagagagcagatgct
gaggattggataaaatgtaatatccccaagaatctcaaacagactaaattccttctcact
ggacttattgataatacagagtaccagttccgtgtcactgctgtgaacaagattgggtac
agtgagccaagtgaagttcctggaaaacaccttgctaaggacattttaattgctcctgaa
gcagaacttgatgcagatcttagaaaggcattggtgctgcgtgctggaaccactatgagg
ctttatgttcctctgaggggcagacctgctccaaaggtcacatgggctaagataaatgca
aacttaaaggagagacaaggaatcttgatcaaaacgtctgagtgggacacaatgttgtat
attgaggatatgaatagatatgatgcaggcaaatatacattgacactggagaacagtagt
ggaacaaagacctacacgattgttgtgaaagttcttgatacccctggaccaccacttaat
cttattgtcaaggagacctccaagaaccatgcatcaataacttgggaccctcctcaaata
gatggtggtagtccaataaaaagttacattgttgaaaagcgtgctgcagagagaaaagca
tggtccacagtttcaactgactgtcctaaaacatctttcagaattactaatttggaagca
ggcaaggcatactgcttcagagttttggccgagaatgaatttggtattggggagccatgt
gagaccccaggtgctgttagagcatcggaaaaaccgggaccagtggtggacttcaaagct
ttattgattacaaaggattcatgtacccttggttggaaaaaaccaatcagtgatggcgga
agtcacattattgcatatgtagtggaagtaatggaaggcgaggataagtggaaaatgctg
atgaaagctaagaatatgcaatataatgccaaggatttagaagatggaaaggaatactca
tacagagtgaaagcagtgaatgaagctggggagggtccagctatagagctaagtataatg
gctaaagaccaaattgttcaacctgaatgtgacttgagaggcttgccagatatgtgctat
attgcaaaagaaggaagtactgtccgactaagtattcccattactggcaaacctgtccct
actgttacatggaagaaaggtgaagatcttaccttgactgacagtggcagagtctctgtt
gagtcaactgctgtaaacaccaccttgctaattcgtgactgccagagaactgatgctgaa
aagtacacaattattctgaagaacagtgctggaaccaaagagtccacaataaatgtcaaa
gtggttggaaagccaggaatacccactgggccaatcaagtttgatgaaatcacagcagat
ggaatcacactggagtggggtcctccaaaggatgatggaggggcagaaatatccaactac
attttggaaaaaaggcattccactgctaataaatgggttacttgtgcctcggcaatacag
aagaccagtatgagagttacaagactccatgatggaatggagtatatcttcagagtctat
gcagaaaacaaatatggagttggtgaatgcctcaaatctgatcctgttgtggctagacat
ccatttgatgtacctgatgcgccacttcctccagaaattacatgcatacatcaagagtca
gcaatgctggtatggtctgatccaagaaacactggaggctcccctataactggttaccat
gttgaattcaaggacagaaacagtctactgtggaagagagcaagcaagacacctctgaga
atgaaggagtgcagagtaactggtttaactgaaggccttgagtatgaattcagggtcatg
gctattaatgtggcaggaattggaaaaccaagccgacccacagagcctcaggttgcgctg
gatccaattgatcctcctggtaaacctgatgtgattagcattacacgaagtacagttaca
ctgatatggactgcaccaaagtatgatggtggtcacagactaacaggttacattgttgag
aaacgggagctacctgggaaggtttggatgaaggctaaccatgtaaatattcagtcttgc
gcatttacagtaacagacttgcaagaaggcagcaagtgtgaattcagaataagagcaaga
aatgcagctggggcaattagtcctccatcagagcaaacagatacccttgtatgcaaggat
gaatatgagccaccagctataactattgacccagaaatgaaggatggtcttacagttaga
gctggtgaaactattgtgataagagcatcaagtatcatcggaaagcctccaccaactgct
gtgtggtctaaaggaggaagagactttaagccttcagatatttgccagattacaagcaca
ccaacatcatctactttatcaatcaagtatgcaagcagaaagaacactggagaatataca
attacagctagcaacccatttggaattaaagaagaacatgtgaaagtaaaagttctggat
gttcctggacctccaggacccattgcagccagtaatgtgtctgctgagaaagtcaccttg
acatggttaccaccagatgaggatggaggctctccaatcaaatcctacactctagagaag
agggaaaccagtcgacttctttggactatgttagcagaaaatattatggattgccgcttt
attgctagtaaattaatccaaggcaatgagtacattttccgtgtctcagctgtaaaccag
tatggtattggtgatgcaacgcagtcactacctgtgaaaatggtggatagctttggtcca
ccaggtcctccttcaaaaccagaaattgacaatgtgagcaagtgctctgtcacaatttca
tggaagagaccagttcatgatggagggagtgatattcagggctatactgttgaaagaaaa
gaaagaagaggtctgagatgggtcagagcatcaaaaaagtcaatatctgatctccgttat
aaagtacaaggccttaatgaaggagttgaatatgaatttagagtcacggcggaaaacaaa
gctgggtttggagaacccagcgaaccatcacagcatgtgatgactaaggatgtatcatat
cggcctggacctccatctaacccacgaattactgacacaactaaaactactgcaacattc
aagtggggaaaacctcactatgatggtggactggaaattacaggatatattgttgagcac
aaaaaggaaggcgatgatgattggattaaagacacaacagggactctgctgagaattact
gaatttgttattgcaaaccttcagcctggaggaaaatacagttttagagttagtgcagta
aatgcagaaggtactggagaaccagctcaagttgaacaacttgttgaagttgtggatcga
gaaaaaactcctgactttgaactcgatgcagaactaaggagaacccttgttgtcagggct
ggtggttcaatacgtatctttgtgccaataaaaggtcggccaacacctgatgtcacctgg
atgaaagaggaaatacctcttaagggtcgtgcccacattgataccacagaatcatacact
ctcttagttatccccgaatgtacaagaaatgatgctggaaaatacatcctgacattagaa
aatgttgctgggaaaaaatctggattcgtaaatgttagaattttggactctccaggacca
cctattaacctgaagccaagagaaataaccaaagacagtattactcttcagtgggaaatc
cctgttattgatggaggttcaaaaattactaattacattgttgagaaacgtgattccact
cgaaaggcatattcaaccatcattacaaattgtcagaaatgttcctttaaagttccgaat
ctcacagagggctcagaatattacttcagagtaacagctgaaaatgaatatggaattggt
gagcctgcagaaacctctgaaccagttagagcatctcaagcacccactgctcccgaaagc
cttaatgttacagacattggaaaggattctgcaacacttgcatggacaaaaccaaaacat
gatggaggtagcagaattactggatatgtactagaagctcaaaggaaaggtgctgaacaa
tggtcacacctgacagttgtgaaagctcttgattatacagcaatgcatttaacagaaaat
gaagagtatgttttccgtgtcatggctgttaacagctcaggacgaagtgaccctcgtgaa
agcagacctgtagttattaaggaacaaaccactgcaccttattttgacctacggggagta
taccaaaaagtagtaattgccagagcaggtgataatgtgaaagttgaaatccctgttctg
ggtcgaccaaaaccagttgtctcttggaagaaagaagatcaagaccttaagcaaacacaa
agaataaatattgaaaatactcccacttcaactatattaaatataagtgaatgcaaaagg
aaagatggtggacagtactcaatgacaggaaagaatattcttggaacagtgacagagatt
attacagttcaagtacatgatattcctggccctcctaaaggaccgattaagtttgatgag
atttcttgtgactacatcatattgtcctgggattcccctgaaaatgatggaggggtgcca
attaacaattacattgttgaaatgcgggaaaccacaggaacatcatgggttgaattagct
gctacggtaatccgtacaacttttaaagctgctcgtcttaccacaggagttgagtatcaa
ttccgtgttaaagcgcaaaacagatatggagttggaccatcaattatatctgaaccagta
gttgcagcatatccattcacagtgccaggaccaccagatactccacaagtcatagccttc
actaaggactccatgacaattacttggaatgagccaaactctgatggtggtagccatatt
ttaggatatcacattgacaggaaagagaaaaatagtatattgtggcaaaaaatcagcaaa
gccctggttgtaggaaacattttcaaatctgcaggacttacagatggaattgcttatgaa
ttccgagtttcagctgaaaatatggctggtgtgggtaaaccgagcaaatcatcagagcca
gcattcgctcttgatccagtagatccaccaggtcagccagtagctattaatattactagg
catgaggtgacacttcactggacaaagcctgaaggtgatggtgggttccctattactggg
tacacagtggaaaagaaagacttaccaaatggacgctggcttaaggcaaactttggcaat
attcttgagacaacctacactgtaactggactcaaagaagatgcctcatatgaattccgt
gttattgcccgaaattcagctggtgctattagtaaaccatctaaaccatctgaagcaatt
acatgcagagatgacattgaagagccaagaattaatgttgatgccaagttcagtaatgtt
gtagtgctaaaagcaggggaagtctttaaacttgaagctgatgttttgggccgaccatta
cctacaatggtttggacaaaagaaggaaaagaacttgaagatactgcaaaattagaaatc
aaaacaacagacttcagtacagctttgattaataaagactcttcaagaacagatggaggt
gctttcacactaactgccagtaaccctggtggctttgctaagtatgtcttcaatgtgaaa
gttcttgataggccaggcccacctgatggtccacttgctgttacagatgtcacttcagag
aaatgtattctgtcctggttgccaccttcacatgacggtggtgcgaagattgaatattac
ataattgaaaagcgtgaaacaagcagacttgcatggactaatgtagcatcagacttgcag
gttagccgattcaaagtaactaagttgctcaaaggaaatgagtacatctttagagtcatg
gcagttaataagtatggtgttggtgaaccccttgagtctgaaccagttattgcaactaac
ccatatgtgccttctgatcctccacaaactcctgaagtaacaacaatcactaaggattca
atggttgtttgttggggacatcctgagaataatggtggaagcaatatttccaactacatc
attgaaagaagagacaaaactggtcttcgttgggttaaatgcaacaaaagaacagttact
gatttgaggtacaaggtatctggacttacaccaggacatgaatatgaattcagaattatt
gctgaaaatgctgcaggcttaagtaaacaaagtccctcaagcccattttacaaagcctgt
gatactatcttccagcctggcccacctggaaatccaagggtattagacacaactaaatct
tctatcactgtcgcatggaacaagccagtatatgatggtggttctgatattacaggttat
attgttgagacctgccttccagaggaggatgaatggacaatcgttactcctaaagaagga
ttaacagctacatcatttactatcactaacttgaaggaaaatcaagaatataaaataaat
atttcagctcttaactgtgagggagttggagaacctgcctgtgttcctggatcaccaaaa
tcagaagatagacagattgcaccagacattgaacttgatgcagatcttcgtaaagttgtt
aacatcagagcttgtggcacattaagactattcgtacccataaagggaaggcctgttcct
gaagtgaaatggtccagagaaaatggagaaccacttgacagagcaactattgaaagcaca
tcatcatttacatcacttcaagtagataatgtaagcaggtttgatagtggaaaatacatg
ttaacagtagaaaatagctcgggaagtaagacagcctttgttaatgttagggtattggac
actcctggagcaccacaaaatctgaaggtcaaagaagttaccaaagagtcggtatcaatc
atctgggacccacctctcattgatggtggttctcgaataagaaattacattgtagaaaaa
cgtgagtcagctagaaaggcttactcaacagttactactagttgccataaaacaagctgg
aaaatcagccagctgcaggaaggaagcatgtacttttttagagttttggctgaaaatgag
tatggagttgggcttccagttgaaactagtgagtcaatcaaagtttctgaaaagccactt
ccccctggcaaagtcactgttcaagatgttacaagcaacagtgttactctgacatgggag
agaccagatcatgatggaggcagcagaattacagggtatattgttgaaatgcagagcaaa
ggcagtgaaaaatggactcagtgcatgactgtaaaaggcaatgaagcagttgttgtaggt
ttaacacaaggcgaagagtacttgttccgtatatcagcagtaaatgaaaaaggaactagt
gatcctcggcaacttaatgtacctgtcattgccaaagatcttgtggttgctccggcattc
aaactcttgttctctacgttcagtgttttggctggagatgacttgaaggtagatattccc
tatgttgctcatccaaaagctgttgtatcatggcacaaagatggtgtccctctgaaggaa
accactagagttaatgctgagacaacagacatgcatttgtatcttgttatcaaagaggcc
tgcagagaagatgttgggcaatacactatcaaaatttcaaacagtgctggagaaaataca
gcagacattggcattgttgttctcgataaaccaggtccaccaactggcccaattaagata
gatgaagtgactgctgacagtatgattttatcatggcagcctccagaatatgatggtggc
tgttccatcaataactacattgttgaaaagagagacacatcaactacaaactggcagatt
gtgtcagcgactgtagccagaacgacaattaaagcagcaagactgaagactggcaccgaa
tatcaattcaggattgcagctgaaaacagatatggaaagagttctgttcttgtctctgag
tcagtgattgctcaatatccatttaaacttcctggccctcctggcgaaccctctgtacaa
acttcttctaaggacagtatgctagttgtgtggaacaagccttctgatgatggaggaagc
aaaatattgggatatcacttagaaagtaaggaacgaaacagtattctttggattaagcaa
aacaaaacgcttattcaggacacaaggtttaaggttactggccttgaagaaggtattgaa
tatgagtatcgagtttatgctgaaaatattgtgggtataggtaaagccagcaaattatca
gaagtctgtgttgcaagagatccatgtgactctccaggcacccctgaagctgttatcatc
acacgaaattctgttacacttagatggacaaagccagagtatgacggaggaagcaaaatt
actgggtacattgttgagaagaaagagcttcctggaggtcgctggatgaaggctagtttc
acaaatataatagaaacggaatttgtggtaacgggtttggttgaggagcagagatatgaa
ttccgtgtcatagcaagaaatgcagcaggtgttttcagtaatccatctgcaagtactggg
gctataactgcaaaggatgaagtagatccccctcacatcaacatagattctcgatatact
caaacagttgttataaaagcaggggaaaacttcaagattgatgctgacatttctggaaaa
cctatacctacaattcactggatgaaaggagatgaagaactagtaaatacagctcgtctg
gaaatcaagaacacagactttactacaactctgagtgttaaagaagctattcgcattgat
ggaggccagtacacactactgctgaagaatgttggtggacagaaatcagtccatgttaat
gttaaagtcttagacagaccaggtccacctgaaggcccagtttctgtttatggagtgaca
agtgataaatgctccattgcttggaaaccaccccagcaagatggtggcagtgatgtatct
cactacattgttgaaaggagagaaacaagcagattagtttggactgttgttgattctaaa
gtacagactctaaatttaaaaatcacaaaacttttggagggaaatgagtacattttccgt
gtgattcctgtgaataaatatgggataggtgaaccacttgaatccgagccagtgattgca
agaaatccatttgtagcccctgattcacctacagcagttgaagtttcaaatgtcacaaaa
gattctatggttgttacttgggaaagacctattaaggatggtggtagtccaattattgga
tatattattgaaaaacgagataaagaaggcgtgaggtggaccaggtgcaataagcgtaca
gtaagtgaattgcgctttagagtcactggacttcttgaaagccgcagctatgaatttaga
gtttcagcagaaaatgctgcaggaattggagtaccaagtgcttcatctatttactacaag
gccttagacccaattttcaaaccaggccctccaaataatgttaaagtgaccgatgtttct
cggacctctgttttccttacatggggtaaacctatttatgatggtggttgtgagattcaa
ggatatattgttgaggtgtgtgaggcaacatctgaagaatggacaatgtgtactccacca
acaggcattgcacagacaagatttgaagtgaagaaattacaagaaaaacatgaatataaa
ttcagagtctgtgctgtcaacaaggctggtgttggtgagcatgccgatgtctcaggaaca
gtcattgtagaagaaaagatggaatcaccggaccttgaccttgatcctgaactcaggaag
atgatcactgtaagagctggaggatcactaagattattcattccactccgaggacgacct
gcccctgaaattaaatggggaaaagctgacggtgaaatcaaagatacagctcagattgac
accacaagtagttatacatctcttgtgatcgaacatgttgacagatttgacagtgggaaa
tatactgtaactgcagaaaatgccagtggagtaaaatctgctttcatcagtgtccgagta
cttgacacaccaagtgaacccataaactttagagtgaaagagatcacaaagaattctgta
acacttacatgggaacctcctgcattggatggtggagccaaaattaaaaattatattgtt
gagaaacgtgagagcacaagaaaggcatattcggctgttgtcacaaactgccataaaatg
tcatggaaggttgaaccccttcaagagggctgcaactatttctttagagttcttgcagaa
aatgaacatggaattgggctgcctgcagaaacagctgaacctctgaaagtgtcagaggtt
ccccagcctcctggaaaaattactgtcattgatgtgacacgtaaaagtgttactcttgcc
tgggaaaaacctgaacatgatggaggcagcagaattctttactatgtagtcgaaatgcaa
gctaaagatgctgagaaatggtctgtttgtgctcaggttaaaacacttgacactgttgtc
agcaatttagctcagggagaagaatatatcttccgagttatggcagttaatgacaaagga
atgagtgacccaagactgcttgctactccagttcaagcaaaggaccttgttattcctcca
gatgtaaagcctgcattcagcaattacagtgtacaggttggacatgatctgaaagtagaa
atctacattgctgggcgtcctaaacctaatattatttggacaaaagatggctcacctctt
aaacagacaacaagagttaatgttgttgacagtgaacatcacacaactcttaatattaaa
gaagcaacaaaagatgatagtggtttatatactgtttctgtgtccagtgttcttgggcaa
aaggaggcaacttttgaaattatcacacttgataaacctgggccaccaagtggcccagta
aggttggaagacattagtgcagaaagtatcactgtttcatgggatccaccaaagtacacc
ggtggttgccagatttcaaactacattgtggaaaagagggacacaaccactactaattgg
atggtgatttctgccacagtagcaagaactacactaaaagtaactaatttgaaaacaggg
gcagaatatcagtttagaatatttgcagaaaaccgatatggcagaagttatgctattgac
tctgagcctgttattgcacagtacccgtacaaggaaccaggcccacctggcactccattt
gtctcttcactgtcaaaggatcacatggttgttgagtggcacaagccaatttcagatgga
ggcagtagtattattgggtatcatctggagagaaaagagaaaaacagtattctttggaca
aagattaataaaacacttattcaggatacccgtttcaaaacaactcctttagaagagggt
attgaatatgagttcagagtgtatgctgagaatattgttggaattggagcctgcagcaaa
gtctctgaaggctatgtggcatgtgatccatgtgatccacctggtaaaccagaagctatc
atcgttaatagacactcagtcacactccagtggacaaaaccagaatacgatggaggcagt
atgattaccggttacattgtcgagaaacgagaccttccagatggacggtggatgaaagcc
agttttgcaaacattattgaaactcagttcactgttactggtctaaccgaagactccaaa
tatgatttcagagttattgcaaagaatgcagctgggactgttagcaagccatctaacagt
acaggatcaataactgcaaaggatgaagttgagcctccaagatttgaaattgaccctgag
ttcagccaggttgttgttgtaaatgcaggggacacatttaaacttcacgctgatgtacaa
ggaaagcctgtaccaacagctctgtggttcaaaggtgataaagaaatggaaaacacagca
agatgtgagatcaagaatactgacttcaaagcaataattatcattaaggatgcaataaga
attgatggtggccaatataacttgcagctaatcaatgttgctgggactaaaactgtgcca
ttcaatgttaaggtcctggatagaccaggaccatctgaaggaccacttactataactgga
gtaacttgtgagaagtgcacgctatcatggcttcctcctcgacatgatggaggcaatgct
gtttctcactatatcattgagaagagagaaactagccgtcttgcttggactgtagttgct
aatgactgtagagctactatgtttaaagtaacaaaacttttaaagggaaatgaatacatt
ttccgtgtaatggctgtgaacaagtatggtgttggtgaaccacttgaatcagcacctgtg
ataatgaaaaatccatttgttccacctggtccaccacaggaacttgaagtaacgaacatt
acaagagactcaatgactgtttgctggatcagacctctgtctgatggagggagtgaaatt
gttggttacattatagagaaaagagatagagctggagtcagatggacaaaatgcaataaa
cgcagagtcacagatctacgcttcagagtaacaggtctgacagaagatcatgaatatgag
tttcggttatctgcagaaaatgcagcaggagttggacaacagagtccaccaactctatat
tataaagcctgtgatccagtgttcaagcctggtcctccaactaatgtgcatctacttgat
accaccaaaaattcagttttgattgcttggagcaagccaatttatgatggtggttgtgat
attcagggatatattgtggagatctgcaaagtggatgaagaggaatggacaatgtgcaca
ccaccaactggcctgactgtcagtatatttgaaattactaaacttgttgaacatcaagaa
tataagattcaaatatgtgccatcaacaaagtaggagttggtgaaccagcatctctacct
ggcactgcaaagcccgaagataaaatggaggctccagaaattgaacttgattctgaacta
cgaaaaggtattgtggtccgtgctggagggtccatgaggatcaatatacctttcaaaggg
agaccagttccagagattagctggtccaaagatgaaggggaaataccgactagagcacag
attgagaaaggtccagatttcactcagctttcaattgatatctgtgacagaaatgatgct
ggaaaatacaccctaaatttagaaaatagcagtggatccaagtctgcatttgtgtctgtc
aaggtattggatacaccaggagcacccctgaatcttgaagtgaaggatattactagggat
tgtgttactcttgtatgggagccaccacttattgatggaggagcaaagattaaaaattat
gtgattgacaaacgtgagtcaaacagacctgcatactcaaatgttactaccaaatgcacc
aagacaagcttcagagtagggaatctcactgagggaggcatttattacttcagagttatg
gctgaaaatgaatttggagttggcctacctgtagaaactcaggatgcagtgaaagtatct
gaagctcccttgtctgtaggaaaggtcactttgattgatgtgactaaatcaagtgcgtcg
ttggcatgggaaaagccagactatgatggtggtagcagaattattggctacttaattgaa
atgcagccaaaaggaacagaagaatgggtggttgcaacaacatcaaagacatgtgaaggc
actgttacagggctgagttctggccaggagtaccttttccgtgttgttgcttataatgat
aaaggaaagagtgatccaaggcctttagctactcccgttgttgccaaagacataaccatt
gaaccaaaatttaaactgacattcaacacatacagtgttctatctggtaatgatctcaaa
attgaaatcccagtaattggacgtccaaagcccaagatcacttggaataaagatgggcaa
ccactgaaggagactacaagggttaatatttctaccataccaaatgcaacaggcctttgt
ataaaagaagcaaacagagatgattctggaaagtatgcagtaactgctgtgaacagcact
gggacagtaacagaggaaatagttattattgttcttgataagcctggcccaccagctgga
cctgtgaaaattgatgaagtaagtgctgactttgtaacaatctcatgggaaccaccaatt
tatacaggaggttgtcaaataaacaactatattgtcgaaaaacgagagacaacaaccaca
aactggcagactgtctctgcaactattgcaaggacaactatcaaaattttaaagctgaaa
acaggttcagaatatcagttccgggtttttgctgaaaacagatatggaaaaagttcttca
ctggactcagtaccagttatggtgcagtatccttacaaagtaccgggtccaccaggtacc
ccatttgtttcatcagtaacaaaggaccacatgcttattgaatggaaaccaccaattagc
aatggtggaactgatattattggttaccatcttgaacggaaagaaaaaaatagcattttg
tggactaaattgaacaagattctcattgctgacaatcgatttaagacaaatgaccttgaa
gaaggtattgaatatgaatacagagtgtacgctgaaaacattgttggcattagtgttcca
agtaaggtttctgaatgctatgttgcccgtgacccctgtgatccacctggaacccctgaa
gctatagttatcacaagaaactatgtcacacttaaatggacaaagcctcagtatgatggt
ggtagtaaaatcacaggatacattgttgaaaggaagaagctacctgatggtcgctggatg
aaagctagctttactaacattattgacacagaatttactatcacagggttaacagaagag
caacggtatgagttcagagccattgcaaagaatgcagcaggcattttcagtgaaccctct
gaaagtactggaccaattactgctaaagatgaaattgaagctcccacagcttcaatggat
tcaaagtttaaggatgttattgtggttaatgcaggagaaacttttacaattgatgctgac
atttttggaaagccagtgcctgatattatatggctaaaagatggaaaagaaattgataag
gcaactccaagaatggaagttaaaacgaccctacagcgaacagtgctgacagtgaaggat
tgcattagagttgatggtggacactatgttcttagccttaacaatgttggtggaacaaaa
actatacctgtaaatgtaaaagttttagatagacctggtccacctgatggccctcttaaa
gtcactggtatcactgcagagaaatgttatctttcctggaaccatccttcacatgatgga
ggcgctagtgtttctcattatattattgagaagagagaaactagtaggttgtcatggact
gtagttcaacctaaaattcaagctgtaagttacaaagtgaccaaactattacctggaaat
gagtatatcttcagaattatggcagttaacaaatatggagtaggtgaagcacttgaatct
gagccagtgttagcatgcaatccattcaaaccaccaagtgcaccatcagtacctgaagct
agtgctataactagagattctatggttcttacatgggaacggcctgaatataatggaggg
tctgaaattgagggctatatcctagagaagcgagacaaagaaggcatccgatggacaaaa
tgcaataagaagagattgaatgacttacgatttagagtaactggacttactgatggtcat
tactatgagtttcgtgtttctgctgaaaatgctgctggtgtgggagagcctagcaaaccg
tcagaactctacaaagcttgcgatgctatatacccacctggacctccaaacaatcctaaa
gtaactgactactcaagtacctctgtctctcttgcttggagcaaacctatttacgatggt
ggtgcaccaataaagggatacattgttgagatgaaagaagttgctgaagatgagtggact
acatgcacacctcctactggtgtagaaacaactcaatacacaataaaacaattaaaagaa
aatgctgagtacaacttccgcatctgtgctctaaatgttgaaggagttggagaacatgtt
gatgttcctgggtctgtggttgcagctgaaaaacttgaagcaccagagattgatttagat
gcagagctccggaaagttgtctccgtacgagcaagtggaacccttcgcttgtttgtcacg
atcaaaggaagacccgaacctgaggttaaatgggcaaaggtggacagtgccatggctgag
cgtgcgcaaattgaagtaacaagttcatacactatgcttgttattgacaatgtcaacaga
tttgatagtggaaaatatgttttgacccttgaaaataacagtggtacaaaatcagcattt
gtcaatgttagagtgctagactcaccaagtgaacctcttaattttgaagtcaaagatgtc
aagagagattcagtaacactttcttgggagcctcctctaattgatggtggagcaaagata
accaattacattgtggagaaacgtgaatcttcaagaatggcatacaccactgttacaaac
aattgcatcaggaattcatttaaagttgatgagttacaagaaggacatatctactacttc
cgtgttctggctgtcaatgaacatggtgtaggtttgccaacagaaacaaaagatccagtc
aaagtatgcgaggcacctttggcaccaggcaaagttacgcttgtggatgtaactcgaaaa
agtgttactctttcttgggaaaaaccagatcatgatggtggcagcaaaatcacaagctac
ataatagagatgcaaactaaaggcagcgataaatggactgtatgtgccacagttaaagga
ctagagacaaccattgatggtctaacatcaggtgaagaatattctttcagaatcattgct
gtgaatgacaagggaaaaagtgatcccaagccacttggagtatctgtgattgcaaaagat
attcagattgagcctgtcattgatttgttattcaacacttacagtgtgagggctggagat
gacctcaaaattgatgttccatttagaggtagaccactaccagaggtatcatggaaaaaa
gatggtcattctttgaaacaaacaactagagtgaatgttctatcatctaagacctcaagc
aaaattgtaattaaagatgctacaagggaagatgctggaaaatatgaaattactttaacc
aacacaattggcactaaatcagctgaaataaatattgttgtccttgacaaacctggtcca
ccaggtgcaatcagagtagatgaagttagtgctgacagtatatcattatcctgggatcca
ccagattatgatggtggttgccaaatcaataactatgtggtagagaaaagagacactact
acaacaacatggcaaattgtttcagccactgttgccagaacttcaattaaagtttcccgt
ttgatccaaggttctgaatatcagttccgtgtttgctcagagaaccgttatggaaggagc
cactttgtagattcatcaccagttattgcccagtatccattcatgttgcctggtccacct
gtaaatgtacgtgttgctgaggcaaccaagacgcacatgcttgttacatggaatagacca
gctagtgatggtggaagtgcaatccttggataccacttggaatgtaaagaaccaagcagc
attctctggacaaagattaaccgaggtcttattacagatacacagtttaaagtatctggc
attgaagagggcttgttctatgaataccgtgtttatgcagaaaacattgcaggtattggg
aaatgcagtaatgcatctgaacctgtggcagcaagagatccatgtgatcctcctggtcaa
cctacagtcacaaacatcactagaacatcagtttcattgtcttggacaaggcctgagtat
gatggtggggctaaggtcacaggttacataattgaatgcaaggagcttccagatggcaga
tggctgaaatgcaatttcactaatgtccaagaaacatattttgatgttacaggccttaca
gaggatcagcgatatgatttccgagtcattgcaaagaatgctgctgggctgttcagtgag
ccatctgatagcacaggccctgtcactgtgaaggatgatgttgatccaccaaccatcatg
atggatgacaggttcagacagttagtagttgtgaaagctggagatgtcctcaaaatcaat
gcagatattgcaggccggccacatccagtagttttatgggctaaagatggaaaagaaatt
gaagctaaagctagagttgagatctcctcttcaaacttctgcactactataattgtcaag
gattgcatcagaagagattctgggcaatatgttttaactttacaaaatgttgctggaaca
agatcagtagcagtaaactgtaaagtgcttgatcggccaggaccttcagctggaccactt
caggtaactggcctaactgccgaaaaatgcactttgtcctggggcccacctcaagaaaat
ggtggtgcagaagtttcccactacattgtggagaagcgtgaaacaagtcgtcttacatgg
acattagtatatggcgatatgaaagctacaacatgcaaagttaccaaacttctcaggggc
aatgagtacatatttagggttttgggtgtgaacaaatttggagttggtgaacctcttgaa
agtgatcctgttaaagctgtggatccatttacagtcccacctgcacccacaaatgttgaa
gttacaagtgtaacaagtgaggcaatgacaatatgctgggaaagacctgcttctgatgga
ggtagtgaaattcttggttatgtaattgaaaagtgtgagaagtcaggtctgcgttgggtt
cgtgtaaacaaaaaacctgtgtatgacctaagagttaaagcttccaatttacgggaagga
tgtgaatatgagttccgtgtttatgcagaaaatgctgctggtttaagtcttccaagtcaa
ccctcatctctaactaaagctgaagacccacagttctttccatccccacctactaagcca
aaaataattgattcaaccaagagctctatcacaattggatggtgtaaaccattgtttgat
ggaggagcaccaatcactggatacagtgtggaatacaagaaaactgaagatgaagactgg
acggttgctgttcaaaatacaaggaatacagaatatactgttgttggactgacatctgga
gcagaatatgtgttcgttgtaaaatctattaacaagattggacttagtgatccaagccct
gcatctgaccctcaagttgcaaaggagagagaagaagagccagtttttgaggttagcaac
gagatgcgcaagactttgattgtcaaggatggtagctcctttaccttgactgtgccattt
aggggaaagccagtgcccaatgtgatgtggaataaagctgatgttgatcttagagtaaga
gcttcaattgacacaagtgatacctgcacatgtattacggtagaaaaagcaacaagaaat
gattctggaaagtatactgtgacattacagaatgttgctgggacatccactttgacactg
gttgttaaggtacttgactctcctgggccaccttcacatgttgagatcaaggaagtcact
aaaaactcagcgacagtgacatgggatgcaccagaaaatgaagggggtgctcctgttaaa
aactaccatgttgatatacgagaggcaaataaaatgggatggacaaaaatcactgacagc
tgtcaccgcttgacttataaagttacggaattgcaagagggaggggtatactatttcaga
gttactggtgaaaatgaatatggacttggtgtgccctctgaaaccaaagaaggaacaaag
attacagaaaaaccaagtcctcctcctaaacttggagttactgatgtcacaaaggatagt
gtctcactagcatggtgtaaaccagaacatgatggagggagcagaataaccagctacttg
attgaagctcttgaaaaaggccaggataagtgggtgaaatgtggtgtgaccaaagctaca
cactttgcagtctatggcctgagagaaaacgtagaatatttcttcagagtccgtgctgaa
aaccatgctggcctcagtgaacccaaagaaatgattcttccagtagttgtaaaagaacag
cttgaatcaccagagattaacatgaaggacttcccacacaatactgtatatgtcaaagca
gggtcgaacttaaagtttgaaattcctgttactggtaaaccacttccaaaagtttcacta
tcaaaggacaatgttgttgtgaaatctacaattagattcaactctgaagtaactcctgaa
ggcctcattgtcactcttcgggaaagcattgctcatgatgcaggcaggtatgacattact
gcctctaattcaagtggaacaacaaagtcctttgttaacattgtagtactggatagacca
agtcctcctcttggtccagttgaaattagcgacatcactgaagacagtgtgagtctcaag
tggcttcctcctatgtatgatggtggcagcccagttactaactttattgtactcaaacgt
gagacaaccactgctaattggacagaagtatcatctgcagtagcaagaggaacaataaag
atcatgaagttgacaacaggggaggagtatcagtttagaatcaaggctgagaatcgcttt
ggcatcagtgatcatctggattctccagctgtcagagtggaactgccatatacaatccct
ggacctccatcaacaccatgggtgacatcagtaacaagggaaagtatcaccgtaaactgg
aaggaacctgtgtcagatggaggaaaccatgtgtttggatatcacttacagatgaaagac
agaaatagcatcttatggcagaaggttaacaaaactgttatccgagctacacatttcaaa
gtaacaaacgtcagccctggtctgatctatgaattcaaagttgcagcagaaaatgcagct
ggcattggtgaaatcagcaaagcatctgatgcagtacttgctattgatgcatgtgaacct
ccagtgaatgtacgtatttctgacattacaaagaattccatcagccttgtctgggaaaag
ccaccatatgatggtggtagcaagattactgggtacattattgagagcagagagtcacca
aaggggagatggtcaaaggccaacttaaccaatattgctgacacaaaattcacagtgtca
ggtttgaaccaggatgagtcctatgaattcagagtctttgcaaggaatgcagttggctct
gtcagcaacccatctcttactgctggtccagtcacatgtgttgatacatatggtgcccct
gagattgacataccaccagagtacttggatgttgtcaaatataaggcaggaactgatgtt
catctgaagcttggaattattgcaaagccacgaccaactattgaatggtataaagatggg
aaggaactgaaatctaatgcacagctgtcaattgtgagcactaaagatgactctagcatt
ttcatcaaggatgttagtcggctaaacagtggaacatatgaaatgaaaatcaagaattct
ttgggatccacatctgcagcaatcagagttcagatattagacaaaccaggacctcctgtt
ggatctatacaattcaagaccatcactgcagacaagattaccataatgtgggatcctcca
gtagatgaaggaggtgcagtggtcacccactacattgtggaaaaacgagaaacaagcaga
gtaatgtggtctatcatatcagaaaaactggaagaatgcattgtatctgtacaaaggctg
attaaaggaaatgagtacattttccgtgtaaggggtgtaaacaagtatggagttggagat
cctttggagtctgaacctgttgttgcaaagaattcatttgtgacccctggaaaacccact
aagccttcagtaacaatgattaccaggtcaacaatgacagtgatatgggagagaccaggt
gaagatggtggcagtgatattgatggatattacttagaaaaacgtgaaaagaagagccta
agctggtttaaagtcatcaaagatcccattcgtgatacaagacagaaagttcaaaatctg
acagagggaaatgagtatcagtatcgtgtttgtgctatcaataaagctggagcaggacct
tactcaaatgtgtctgacttctacaaagcaaatgacccagttgaccctccaagtgaaccc
actaaacttaaagttgttgattcaaccaagacatccattacgcttggatgggtgaagcct
gtgtatgatggaggcagtgagattactagctacattgttgagcagagagtgtctgatgag
caagactgggttgttattagctcccgagatgaagtgagaaccacagagtatgttgtgtct
catcttaaacctgggatctactatttcttccgtgtctctgctgttaactgtgttggagct
ggacaaccaatagagatgggccaacctgtacaagctaaagatattcttgaggaagctgac
attgatctcgatgttacaatgacaactcagtatacgatcaaggcaggaagagatcttgaa
atcattattccactgaagggaagacctgcaccaaatgtcacttggagaaaggcagacaag
aacattagcagtgatccaaagtacaacattcataatactgaatcatcaactgctcttgtg
attccaaaggtcacccgagatgactcaggcaaatatcttctagagattgaaaatggtgta
ggtgaacccaagtcaattactgtatctgttaaagtactcgacactccatcagcttgccag
aaactagtagtgaaaaatgttactcgtggcaaggccacattgagctgggagccacctctt
atagatggtggatctcaaatcacaaattatatcattgagaagagagatgcaacaaaaaga
gcttactccagcgtgactactgagtgctcgaacacaacatataaaattgaagacctctct
gatgaaatatgctacttcttccgtgtttctgctgagaatgaaaatggagtcggtgatcca
tgtgagacagcagagcctgtaagggccacagaaacacctggtcctgtaaaagatctcgtc
atgaaagataccaccaaatcatctgtaatactacattggacaaaacctgatcatgatggt
ggaagtcacataactgattatgtaattgagaaaaaagcaagggatgaaaaacagtggaca
gtagctggcacctctaaacggtgtctctatgaggtaacaaatcttaatgaatttacagtc
atggatttccgagtcttttccaggaatgagaaggggcaaagtgacttttcacaaattggg
cctatcacagtgcaagacttaattatcccgctgaaagcaaaccttgcagactatccagga
ggtgaagtcagtgtacgtattggacaaaatgtaaatattgaactcccatacatgggtaaa
ccaaaaccagccattcggtggtttaaagatgatattccactaaaagagagtgagcaggta
cgcttcaagttgactgagaacaaagctgcttttacaattaggaatgtaagaaaagataat
gcggggaaatacacactgacacttgataacaaaattagtaaagaatcattccacattcaa
gttgtcactctcggtccaccatctccccctattggacccatacggtttgatgaaatcaaa
gcacaaagcattattatatcctgggatcaaccaattgatgatggtggaggagaaataaca
tgctacagtgtggagaaaagagaaacttctcatgcagcttggaaaatggtttgctcaagt
gtagttaggacaacatttaaaataccaaacttggttaaaggaacagaataccaattcaga
gtacgtgcagaaaataaatacggagtaagtgaagctctgacttcgcaagatgtcattgca
caacatcagtacaaaccaccaggacctccaggaaagcctgttgtttataatgtcacaagt
gatggaatgacagttcagtgggatgcacctgcatatgatggtggttcaccaattactggc
tatcatgtggagaagaaggacaggaacagcctcctctggacaaaagtaaattcttctgtg
atctctggaagagattacagaatcattggtcttattgaaggtctggaatatcagttccga
gtatatgcacagaataatgctggtttgagtattgccagtgaaacaagtaagcacactcta
gcaatatctccagtcgatcccccaggcacaccaaattgcattgatgtgacaagagaatct
gttacgctgaaatggagtgctccggaacgtgatggaggcagtagaattgttgcctacagc
gttgagagacgccaaggaaggggccgttggttaagatgcaactttattgatattagtgaa
tgccagttcacagtgacaggtcttgcagctggagatcgatatgagttcagagtaattgca
agaaatgctgtaggcactgttagtccaccgtcacagtcctctgggtatataatgaccaaa
gatgaaagcatttctccaagcatcgagttcagtgcagagaaatgtcttacagttaaagca
ggagaaaatatcacaattaatgtcaatatcactgggcgacctgtaccacaagtaacatgg
tacaaggatggaaaagaaattgacaaaaagatgatgattgacatcacaacaaccattgga
tcaagcactctcttcatcagagattctgaccgtgatcaccgtggaatatatactgttgaa
gctaaaaatagctctggaaccaagaaggaggatattcttgtcagagtccaagatacacct
gggccacctcacggaccaatacgattcacaaatatctcagctgagaaagcaacaatatgg
tggagtcctcctgacaatgatggctgtgctgccattactcattacgttattgaaaagcgt
gaaacatcaagaatttcctgggccctcgtgacagacaagtgtgacgcctgctctttcaat
gccacaaaactgatccaaggcaatgagtaccagttccgtgtttctgcagtcaacaaattt
ggtgttggtagaccactggattctgatgccattattgcacaaatgcaattcactgtaccg
gaagctcctggtacccctgatgcaacccatgtgactggcgatagcattacacttacatgg
acaagaccaagatcagatgggggaaatgaaattaagcattatattctggaaagacgtgag
aagaagagcctaagatgggtgaaggtttcatctaagaggcccatcactgagcttagatac
agggtaacaaaccttactgaaagcaatgagtacgaattccgtgtaatggctgaaaatagt
gctggaataggaccagcaagcagcacatcaagactttttaaatgcagagagccaacaagt
cctcccagtgctccaactgtagtgaaggtcacagattcaacaaaaacttctgtcagcttg
gaatggacaaaacctgtatttgatgggggtatggagatcataggctatatcattgagatg
tgcaaggccagcttagaagaatggcacagagttaactcatcaacatgcatcaacacgaat
tacacagttactgatctggaagctggtgaagaatataaattccgtgtgtgtgctgttaat
ggagctggaaaaggagaaacatctgagattcctaattcagtgaaaactgtggacaggctt
acttccccagaaattgacattgatgcaaaattcaaacaaacacatattgtgaagaatgga
gggactgtttgtcttcatattgccttcagaggaaaaccagctccccttgcaacatgggca
aaggtagatggagagcttggggtgatggttgatatcaatactacagagacctatagtacc
ctgaccattgagaactgcacaagatatgatgctggaaaatatacactcagtcttgaaaac
aacagtggccgcaaatctattacatttactgtaaaggtgctagatacgccagggccacca
ggacctatcacattcaaggatgtaacaagaggagctctgacactgatgtgggatgcccca
acgaatgatggaggagcccgtattcagcattatattgttgagaaacgtgaggctagccgc
cttagttggcaggaagtaagtaccaaatgctctcgtcaaatactgagagttaccaatctt
gcagcaggcattccatacttatttagagttatagcagaaaatcagtatggccagggtgaa
ccatatgaaatgtcagatcctgtcattgccactgaagaacctgctccaccaaaaagactg
gatatcattgatacaacaaattccacagccactttagcctggttaaaacctgagcatgat
ggtggaagtcatatcacaggctatgttgttgaaacaagagctaaaggctcagatcattgg
gtttttggaggtcaaacaaaatctttgcacttggttatcgaaggccttgttgagaataca
gagtatgaatttcgtgtcaaggctaagaatgatgctggcttcagtgacccgcgggaagct
tttgcctctgtaatcatcaaagagcctcgcattgagccaactgctgatcttagtggtatc
actaatcagctcattacatgcaaaactggaagcacttttaccattgatgttccaatcagt
gggagaccagctcctaaggtaacttggaaacttgaagaaatgagactgaaagaaactgat
aggatatcagtgaagaccaccaaggaaaggaccacactgtcagtgaaagattgtataaga
ggtgatagtggaaaatattaccttattcttgaaaatgtcgcaggcgctaagacctttact
gtcactgtcaatgttgttggaagacctggtcctcccactgggcctgttgaagtttcatca
gtttcttctgagtcttgtgtgctgacatgggcagaacctgaagatgatggtggtactgat
gtcaccaactacattgtggaaaaacgtgaatctggttcagccacatggcaacttgtgaac
tccagcgtgaaacgcacaactattaaagtcactcatcttaccaaatacatggagtacact
ttccgtgtctgtgctgagaacagatttggtgtgagcaaaccaattgaatctcaggccatt
gtggctgagcatccttttgttcctccaagtccaccgtctcgaccagaaataatatccgtt
actgcaaatgctatgactatttgctgggaggagccatatcatgatggcggcagtaaagtg
actggatactggattgagaagaaagagcgcaacaccatcctttgggtcagggagaataag
attccatgcttggagcgccacttcaaagtgtcctcactcattgaaggccttgaatatcag
ttcagggtttatgcaatgaacattgctggcttgagcaaagctagtgaagcctcaagacca
gtagtagctttgaatcctgttgatccacctggtaaaccagaagttacggacgttaccaaa
tccactgtatcaatcaaatggacagaaccattaaatgatggtggcagcaagattgtagga
tacatagttgaacgcaagcttttcagtgatgaaggagaaggtcgttggctaaagtgcaac
tatacaaccatcacagaaacttacttcactgtagcatcactaggggatggagatatctac
gagtttcgtgtcattgcaaagaatggagctggagtacacagtatgccctcagaatcaaca
ggaccagtcacatgcaaggatgaatacactcctccgagggcagagcttgatgacaaactt
gttggcgagacggtcacaatcagagctgggtctgaccttgttcttgatgctgcagttggt
ggcaaacctgagccaaaggtcttctgggctaagggtgaaaaagaactggagcatggtgaa
aagtactcactgcaatacaccagtacacgtgctatggctatcatcaagtcctgtgacaga
aatgattctggaaaatacattctaactgtccaaaatgctagtggaatcaagacagctgca
gtcattgtaaaagttcttgatacacctgggccttgtgagggtatgattacagttagcaga
gtaacagaagagaagtgcactctttcttggaaaatgccactagaggatggtggcgactcc
gtctcccactacattgttgagcgacgtgaaaccagtagactcaactgggtactcatggaa
gctgagtgcaagaccctttcttgcgttattacaaggttgatcaagaataatgagtacatc
ttccgtgtcagaggtgtaaacaaatatggacctggtgtaccacttgaatctgagcctgtt
attgccagaaatgcatacacaatcccatcgcctcctggtgtaccaaatattgttgctgta
ggaaaggaacatgtcattattgaatggatgaagcctgagagtgatggtggcagtgaaatt
aaaaactatctggttgacaaacgtgaaaagaagagtgttaggtggaccagagttaacaaa
gagtacacagtttatgatacgagacttaaaattactggacttctggaggccagtgattat
cagttccgtgtgacagccatgaatgcagctggaaacagtcagccaagcgaagcatcagaa
tatgctctatgcagggagccaacatatactccagctcctccatcagttcctcgtgttact
gacaccaccaaacacagtattaatctgtcatggacaaggccaatgtatgatggtggttca
gatgtaactggatatattgttgagatgctggaggaaggtacagagcagtggtacagggca
caacaaaagattgtgaaaaccacagaatacactgctggtggtcttgcaagcaacaaaaag
tatagcttcagggttgctgctgttaatgccagtggtattggtgaattcagtgaaccttct
atagaaacagagcctctggaaagaattgaaatacctgatcttgaacttgctgatgatttg
aagaagactgtctgcataagagcgggaggatctcttcgactatttgttgctgtatctggc
agaccaacacctgtagtaacctggagaaagccaggtgtagatctccagagtcgagggttt
attgatgttactgatagctacacaaccctaacaattgagaaagtacatcgatatgatgct
ggaaaatacaccattgaagctgagaatccttctggcaagaagtcagcaaccattcttgtt
aagatttatgatactcctggaccaccaggttgtgttaaggttaaagactatacaagagac
tctgtggttattacatgggatgtcccaagtattgacgggggagcacctgtaaataattac
atcatagagaaacgtgaagcatccatgaaatcttacaaaacagttacatccaaatgtaat
aaaaccttgtatagaatcaccggactgactgagggaactctgtactttttcagagtttta
cctgagaacatatatggtgttggtgagccttgtgaaataagtgatgcggtgttagtatgt
gatgttccaatgattcctcaaaaattggaagttttagatgtaacaaagtctacagtaaca
ctggcatgggagaaaccacttcatgatggtggcagcaaacttactggatatattattgaa
gcttgtaaatttggaacagacagatggatgactgttgctacattaaagacaacggtgttt
gagcacactattgtttctctgaatgaatctgagcaatatctcttcagagtcaaagctagt
aacagcaggggaatcagcgagcccagagagattgtatcacctataaccattcaagaacag
agagttatgccaaagattgatctagccggtattccacagaagactgttaatgtaccagct
ggcaaaccaattgagctccacattcccatctctgggagaccaccaccagtttgttcatgg
ttctttggtggcgctaaaataaaggaagttgatcgtgtaaagattgaaactactggaaaa
tatactaaactagaagttcgtgaaaccacaattgatgatacaggtgaatacacacttgag
gtaaaaaatgtcacaggaatcgccacagagatcatcaaagtcatcattcttgacaaacct
ggagtgccagtaggacctttgagaattgatgaagttgatgctacatctgtcactgttagt
tgggcaccaccagagaaagatggaggtgcgaatatcagtggctatgtggttgaacagcgt
gatgctcaccgtcctggatggctccctgtatctgaatctgttacccggccaacattcaag
ttcactagacttacagaaggaactgaatatgtgttccgtgtagctgcaacaaatcgcttt
ggcattggatcattcttgcagtcagaaattgtggagtgcagaagtggcaagactgtacca
ggagctcctagtagacctgaggtgtttgatgtatctcatgatggaatgactattacatgg
ctaccaccagaggtagatggtggttcccaggtgtctggatatatcattgaacgcaaagag
gtcagatctgacagatgggtgcgtattaataagaatccagtaacaatgacaagatacaga
tctacgggtctgattgaaggccttgaatatgagcacagagtcactgctataaactccaga
ggccatggaaaacccagccctacctctaaacctgctgtggcaatggatcccattgctcca
cctggggtaccactgaatccaagagttatagataccactcggacatctgtctctttggct
tggagtcctcctgaagaagagggtggatcaagtattattggctacttgattgaaatgcag
aagattgatcagattgaatggaccaaatgcaacactactccagtaaagatttgtgaatac
actctgacgcacatgccccagggagctgaatacagattccgtgttatggcatgcaatgct
ggaggccctggcgaaccagcagaagtcccaggagctgttaaagttacagagatgcttgaa
tatcctgattatgagttggatcccaagtactcggaaggagttgtggtcagacagggagga
gtcattaggctctctgttcctattaaaggaaagccaatcccaatatgcaagtggacaaaa
gatggccgtgacatttctcatagagctatgattgctaccagcgatgagctcacagaactt
gtaattaaggaatctcacagggatgacactggtacttatgaccttgtgttagaaaataag
tgtggcaaaaaggcagtgtacataaaagtcaaagttataggatggccagatgcacctgaa
ggtccactggaatttgatgacatccaggctcgctctgtcagagtgagttggagagctcct
tcagatgatggtggctctgatattcttggttacattgttgaaagacgagaggttcccaaa
gcagcttggtacactgtggactcaagggtgggagaaacttctctggttgtgaaaggacta
aaagaaaatgttgagtaccacttcaaggtgtcagctgagaatcagtttggtgtcagtaga
tcactgaaatctgaacagtcagtcacaccaaagacaccgttatgtccaccagaacctccc
agcaacccaccagaaattatggatgtcacaaagagcactgttgccctatcttggtccaga
cctaaagatgatggtggttctcgcattactggctattatgttgacagaagagagatgtcc
acagaaaagtgggtgcgacacaacaaaactcaaattactacgactatgtacactcttact
ggactcatacctgatgcagaatatcagttccgcatcattgcccaaaatgacgttggtcag
agtgagcctggaccctcctcagagtcagtcgtatgcaaagatccatttgacaaaccaagt
caacccggtgaaatagatataatctctgtcacaaaagactccatcaccattcactggcaa
cgtcctgagtgtgatggtggaaaagagatcttagggtactggattgagtacagacagtct
ggtgaaagtgcctggaagaaatgtaacaaagaacgctcgaaggatagacaattcaccatg
ggtggtctcatggaggcaacagaatatgaattccgggttcttgctgaaaatgaaagcggc
ttaagcagaccacacagaacagctatgggcattaaaactaaactgagtgttggagaagca
ccaagtctcaaagaagaaatggaagatgtcaccacaaaacttggacaatcaggcacactg
aaatgtcaaatcattggtagacctcttcctgaaatcaagtggtatagatttggaaaagaa
ctgattcagagccgaaaatacaagatgagttcagatggtcggaatcattcactcactgtt
gttacagatgagcaggaggatgagggtctctacacttgcagagctataaatgatgcaggt
gaaatagaaaccagtggcaagctcttcttgcaggcagcccctcaatttcattctggattc
ccactgaaagaaatatattatgcaggatgtggtacgagcctacgtttacatgttgtatat
attggacgccctgtgccacagatcatgtggttctatggcaagaaacctttaaagccttct
gataatatcatcattgaaaacactgaaaattattcccacttggtagttagaaatgtgcag
cgcaaaaccaatgcaggaaaatacaaggtccagatgagcaacatctttggatcagtggac
acggtacttcgtgttgaaatccaagacaaaccagctatgccagaaggaccagttgttgtt
gatgcactgttgaagaactctgtgataattagctggaaaccaccagcagatgatggtgga
gcaatgattacaaactatgttgtggaaaagcgtgaggccaaagaaggcgagaagtatcac
ctcgtatcttcgtcaatctctggaacatcttgccgagttccaaaccttcttgaaagtgct
gggtattacttccgtgtttctgcacagaatcagtttggaatcagtgatcctcttgagatt
ccatctgtggtcatcattaagagtccatttgaaaagcctggaattcctcaacagccagtt
gttactggagtgacaaaggactcttgtgttgtcacgtggaaaccacctacaagtgacgga
ggtgccaagattaaaaattactaccttgaaaaacgtgagaagaaacaaaacaaatggatt
gctgtaacaactgaggaaattcatgaaacaatgtacaatgtcaaaggtctcattgaaggc
tttgaatatgaatttcgtgtgaagtgtgaaaacattggaggtgaaagtgaatggagtgaa
gtgtcagcacctgttgttccaagatcagatacagctgtgcgtgctcctggatttaaagaa
gaactgagagatatgagtgtcaaatataagagtaatgcaacatttgtatgtaaggtcact
gggcatcctagccctgtagttaagtggtacaaaagtggaaaagaaattctgcctgatgga
aagaaaatcattgtgcaggaattcaaaggtggctatcaccaactggttatttctgctgct
gatgaagaagatgccaccacctatcagatcagagctacaaaccaggaaggatctatttca
actactgtcaccctggaggttgaagttcctgcaaagattcacttgccaaagcatctgcaa
ggaatgggagcagtccatgctctccgtggagatgttgtaaccattaagattccatttagt
ggcaagcctgatcctgtcataacatggcaaaaaggacaagaaattattgataacagcgga
caccatcaagtcattattacaagatcattcacatcacttgttttccccaatggagttcaa
agaaaagatgctgggtattacattatttctgccaaaaatagatttggtgctgatcagcag
acagttgaacttgatgttgcagatgtacctgatgcaccaaagaatataatgatcagtgac
ctttccagggattctgtcactctgacctggtctgcacctgccagtgatggtggaagtcag
attatcagctatattctagagaagtgtcctacttcaggagatagatggatccgtgtagcc
cagacccaggacactcattacacagtcagtgtaattggtaaaacacagtatcaattccgt
gttattgctgaaaacaagtttggtcagagcaaaccatctcaaccaactgaacctgtggta
acaaaggaagacaagtcaataattcgaaattatgatgaagaagttgatgaaaccagagaa
attactaaagaggaagccccaagttcaagtatgaagacactatctgctatgtattcgatt
gctgaagagcttgggcgtggacagtttggcattgttcatcgttgtgttgaaacaagctcc
aagaaaacatttatggctaaatttgtcaaagcaaaaggtctggaccaagcgttagtggaa
aaagaaattgaaacattcaacatggctcgccacaagaacatcttatatctccacgagact
tttgaaagtctccaagaattagtaatgatctatgagttcatctcaggagtggacatattt
gaacgtcttggcacagctaactttgatctcacagaacaagaaattgtgaggtacattaga
caggtgtgtgaagctcttcagttcctacacagtcacaaatatgctcattttgacattaaa
ccagaaaacattatatacactacaagaaaaagcagtaatattaaaataattgagatgggt
caagctagactcctaatacctggagagaatatcagaattcagttcactgcccctgaatac
tgtgcacctgaagttcaccaacatgacatggttagtactgttactgacatgtggtcagta
ggtgttctaacctatgttcttctaagtggactcaatccatttacagctgaaaatgctgag
aaaatgattgagaaaatttataatgttgagtacagttttgatgctgaggcctttaaggat
acaagtcttaatgcaatggactttgttgaccggcttctaactaaagatcgcaaacaccgc
atgactgcagctgaagccttggaacacccctggctgaaaatgaagacagaacaacttagc
accaaagtaataaagactctgaggcacagaagatactatcatactttagtgaagaaagaa
tataactttgttgtttcagcagctcgaattgcctatggtggtgctattagaagtcagcga
ggcgtctcagttggcagagtaaagatagcaccgtatgaacaaggtgtgaaagctggtcaa
atcatgcatggtgttgctgaagaaggaggacatgtcagatttgtctgccatattgagaac
tatgacacgactacagaagtaacatggtattttggagctagacaactagaggcaagtcac
aagtatgaaatcagctactcaaatggagttgctgtaatctatgtcaaagacattgctgca
gccgatgatggtacctacagatgcaaagttgttaatgagcatggagaagacagtgcttat
gcagagctctttgttgaaggtgtaagatcatatcgtgagtacttcatggaacgcactgtg
aaaaaagtgaaaagaagaatagacacaacaagactaattcaaagaccaccagagttcacc
ttacccttatataaccgaactgcttacactggtgaaaatgtacgctttggtgtaaccata
acagtgcacccagagccccaagttacatggttgaagtctggacagaagattgttccagga
gatgatgacaagaagtataccattacaagtgacaagggtctgtatcaacttgtgattcac
aatgttcagactgaggatgatgctgaatatacagttgttgctcaaaacagatttggtgat
gacagttgtacagcacggttgactgttacacctcatccgattattgcagacacaatgaag
ccacttttcaaacgtctcttggcaaatgtagagtgcaccgagggtgaaagtgtccgcttt
gaactgagagtgacaggaagtccaacacctgccttaaaatgggagaaagataatttgaca
ttggcatttggccccaaaattgaagttattcaggaggacttggaatattatgtactgcac
atacgagaaacacttcctgaagattctggcacctacagagtcactgcttcaaactctgct
ggatctgcaagctgccaagctacactaaaagtggatcgtgtcacatatgcaaagagagag
tacagaaatgaggaggagagagagaaatatgttcagagacaaattggaaagaccctgaaa
ttagctcagtacctctcaagcactgaagtaactccacttaatcctgttgcacaagaggca
ttgaaagaagctgcacatctgtataaaccagcagtgagtaccaaacatgtacaaggtgaa
tttgatattgaagaggagcaagaagaaaggaaaatccagatagaagaaaagagaattcgt
atgccatatgaagttccagatcgtcgtgtccatgctccatctgcccttgaagacaagaga
attaaacactttgtacctctgtctgaaatgaaatggtacaaaaaactgagcgaccaatat
caaatacctgagcgaatggaaagatatgtgcagaagcgacaaaaacgtattcgtctctca
agatgggagcaattttatgttgttccactaccaagagtaacagaccagtacaagcctaga
tggcgtattccaacaatttcaagagatgatctggaaactgtaagaccttctaggcttcgt
acaccatctcctgagtctgagtctttgtatcgactgagaagaagatcccttggtgacctc
tctgatgaagagcttcttcttcctgttgaggattacttatcattgaagaggactgaagag
gaacgacttcggcttgaggatgaacttgagcttggcttttctgcatctccacctagtcac
agtcctgtacgctttgagttgtcttcacttcggcgtttatcaccaaggcaaaaaacatat
gaagaagtggaagaagaagaggctgaattgcaccgtctgcacactaaacagaaagccaca
ggaaaaagacatgcatcttacaaagagagggaagcacatgtttcttcagtaacaaaggag
actttgaaagcagttgaacaagttcatactactccatcagtttcacactttctgaggagg
cggagatcattgtctcctacatacattgaactaatgcgtcctgtgtctgaacttattagg
ccttcacgtgcacatctagcactagagactgaggatgaagcttctgagagaagatcccct
actcctgaaagaacacgccctcgctccccaagtccagtttccaccgagagatcatcaaga
tcatcttccagatttgaaagatctgcaagatttgacatcatgtccaggtatgaggcaaga
aaagcagctctcaaatcagaaagaaagtatgaagttgtgattcagcaacctttcagtctt
gaccattccccacgcataactgtaagaatgcgttctcatcgggttccttctggtcagaat
accaaatttactttgaatgttcaggctaaaccagaagctgaaattaaatggttccacaat
ggacaacagattcaagagagcagcaaatatcattttaccaacatgagtggagttttgact
ctccaggtgtttgattgccaggctgaagacagtggtacttaccgtgttgtttgcacaaac
tcaaagggagaggcttcagattacgccactcttgatgtttcagccggagaatattcgaca
tattcttctcgtcgaaaagatgaagaaccacctgcaaccttttttccagaaatgaccaag
accgatttttaccatgtctcttccttaaagacagcttccacatctgaaacacacatagaa
gtgaaagaaactaagtcaaagctcacagaaacacatgcagttcatgcatatgcatcttca
gaaaagaaggaaaaaattatggaagccaagaaagaagaagaaataacttttcacatgaag
gggaaagccacaatgccagccagaatacttacaaaaccacaatctctgactgtgtcagag
ggcgagactgctaggtttacatgcgacattgatggggaaccagcagcttttgtcacttgg
atgcatgaagggagaacaattgtttcatctcatcgttaccatgttactacaacacaatat
aagtctacttttgagatttcttctgttgagttatctgatgaaggctcttacacagtgacg
gtccagaactctgaaggcaaacaaagtgcacaattcaatctaagcattcgccgggcagta
caaaaagaaaagatagcatcatcacataaggtaaagtcaccagagcctagagtgaaatct
ccagaacctgcagctgccaggtccccagaacctcatgttaagtcacctgaacttataaaa
ttatctaaggttaagtcacctgagtccaggctaaagtctccagaacccacagccactaag
ggtatagaatgtcaaatcaagtcacctgaaccctttaaatctcccaagagaataacatct
ccagaaccagatacctcaccacagaagattagatccccttctacactcatatctcaaaag
ggtaaaattcctccaaaaattatgcagcaacttaaggcagaagcatatgaggacaaagtg
aagatgtcttgtgttgctgaaagcagtataaatgaagttgtatggtacaaagatgggaag
aaactgacgcaaggcagtcactatcacttccataactctgccgatggcacttgcagtctt
agtgtccatgacattaatgagagtgatcaaggggaatatgcatgtgaaatcattgctgaa
ggaggggtctcaagaacatcattttcatttgttggtcaagtatttcacactatatacaca
aaaatcacaactttcatggagactaaaaaatcttttcagaaaaaggaagtggattcctct
gcaataacaagtctaaaatatgccaaagcacttcaaacagaagctcagaaagaagctgtt
tcagcatctcataagaaaacagaggtcaaagaacaaattgtaaaaaaggagattttttat
gaagaagttcagtcttacacggaagtaaaagcatctcacactgaggtgacaatgcaagag
ggtcagtctcttactttaaaagcaaacatccctggagcatctactgtaagatggatcctg
aatggagaagagctgattaattcaggggagtacagatatggtgtatctgggaatgaccac
actttgactatcaaaaatgtcagtcagcgtgaggaaggaatcataacatgcgaagctaaa
actgaagagggcattgtaaaatgtcagtttgacaccactgtcacttcgaaacgtgcaaat
gccccttcatttctagtacaaccaaagtcacagaatgtcaatgaaggacaaaatgtgatt
ttcacatgtgaaataacaggagatcccactcctgaaattgagtggcttaagaataatgtt
ctggtttgcttgtcatccaagctgaaactgagccgttctaaaaatgtttacaccctggag
attaaagaagcttcaatttcagacagtgggaaatacacagtaaaagcaaagaatatgtat
ggacagtgttctgccactgcatcattaaatgttcttgctctggttgaagaacccacaaaa
atgatagttttggagaaaagtgctacagctgccagtgtgcacgagggtttctctaccaag
gcagtccatatggccacctctatgcaggaggcctccttcagaagctccagcatggctgag
gttaaaattgaaagcatgtctgcaactagcatgtcctcaatgacatctgagtcaatggta
gctatgagctccagcagtagaatggaaatgtcaagtcattcgcacatagaggggtcttct
ctgagaaccattaaacacagtcatcaaggttcaccacctaaaattgaagctcttcctgaa
gacatcagtattgagaaaggaaaggtccttactatatcttgtgctttctctggagatcct
gtgcctgagattgagtggactcgttcagggaggacactgcccagtgcagaggacagtggc
aggttccatgttgagaccgcagaagacctcacaactcttatcatcactaatgtgaaggaa
aaggatgctggagcttacaccctcaaactctccaatgaattaggatctgacactgcaaca
gtaaatatcagcattcgctccctgtaa

DBGET integrated database retrieval system