KEGG   Scleropages formosus (Asian bonytongue): 108924493Help
Entry
108924493         CDS       T04919                                 

Gene name
gucy1b1
Definition
(RefSeq) guanylate cyclase soluble subunit beta-1 isoform X1
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00230  Purine metabolism
sfm01100  Metabolic pathways
sfm04270  Vascular smooth muscle contraction
sfm04540  Gap junction
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    108924493 (gucy1b1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    108924493 (gucy1b1)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    108924493 (gucy1b1)
Enzymes [BR:sfm01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     108924493 (gucy1b1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB 4_1_CTD
Motif
Other DBs
NCBI-GeneID: 108924493
NCBI-ProteinID: XP_018591426
Position
16
AA seq 613 aa AA seqDB search
MYGFVNHALELLVLRNYGPEVWEDIKKEAQLDVEGQFLVRIIYEDAKTYDLVAAASKVLK
IDAGDILQMFGKMFFEFCQESGYDTILRVLGSNVREFLQNLDALHDHLGTIYPGMRAPSF
RCTDAEKGNSLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIEMKVIQQKSEDCDHIKFL
IEEKDSEEEAFYEDLDGFEENGTQETRISPYTFCKAFPFHLMFDRDLVLTQCGNAIFRVL
PQLQPGTCSLPSVFSLVRPHIDFSFHGILSHINTVFVLRSKEGLLNVEAPECEDDLTGTE
ISCLRLKGQMIYLPEAENILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFR
EEYKLTQELEILTDRLQHTLRALEDEKKKTDRLLYSVLPPSVANELRHKRPVPAKRYDNV
TILFSGIVGFNAFCSKHASAEGAIKIVNLLNDVYTRFDILTDSRMNPYVYKVETVGDKYM
TVSGLPEPCGHHAKSICHLALDMMEIAGQVKVDDEPVQITIGIHTGEVVTGVIGQRMPRY
CLFGNTVNLTSRTETTGEKGRINVSEYTYRCLQSEENADPQFHLEYRGPVAMKGKKEPMK
VWFLSRKSAEAEA
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgtatggctttgtcaatcacgccttggagctgcttgttctgagaaattatggccctgaa
gtatgggaagacatcaagaaggaagcacagctggatgtcgaaggccagttcctggtcaga
atcatttacgaggatgccaaaacatatgacctggtggcagccgcaagcaaagttctcaag
atcgacgccggtgacattctgcagatgtttggaaagatgttctttgagttctgtcaggaa
tccggatatgacactatcctgcgtgtgctgggttccaacgtccgagagttcctgcaaaac
ctggatgccctccatgaccacctgggtaccatctacccgggcatgagggcgccctccttc
aggtgcaccgacgccgagaagggaaacagcctcattctgcactactactcggagagggag
ggattgcaggacatcgtgatcggcatcatcaagacggtggcccagcagatccatggcacc
gaaatcgagatgaaggtcatccagcagaagagcgaagactgtgaccacatcaagtttctg
atcgaagagaaggactccgaggaggaggcgttctacgaagacctggacgggtttgaggag
aacggcacccaggagacacggatcagcccgtacactttctgcaaggccttccccttccat
ctcatgtttgaccgggacctcgtgctcacccagtgcgggaacgccatcttccgtgtcctg
ccgcagctccagcccgggacctgcagcctgccgtcggtcttctccctggtgcgaccgcac
atcgacttcagtttccacggcatcctgtcgcacatcaacaccgtcttcgtgctgaggagc
aaggagggcctgctgaacgtggaggcccccgagtgcgaggatgacttgacgggaaccgag
atcagctgccttcggctcaagggccagatgatttacctgccggaagcggagaacatcctc
ttcctgtgctcccccagcgtgatgaacctggatgacctgacccggcgggggctgtacctg
agcgacatcccgctgcacgatgccacgcgggacttggtgctgctcggggagcagttccgc
gaggagtacaagctgactcaggagctggagatcctgaccgatcggctgcagcacaccctg
cgcgccctggaggacgagaagaagaagacggacagactcctttactcggtcctgccccca
tcggtggccaatgagctccggcacaagcgtccagtccccgcgaagcgctacgacaacgtc
accatcctcttcagcggcatcgtgggcttcaacgccttctgcagcaaacacgcctcggcc
gagggcgccataaagatcgtcaacctgctcaacgatgtgtacaccaggtttgacatcctg
acagactcgaggatgaacccctatgtttataaggtggagacggtcggggacaagtacatg
accgtgagcgggcttcccgaaccgtgcggacaccacgcaaagtccatctgtcacctggcc
ctggacatgatggagatcgccggccaggtcaaagtggacgacgagcccgttcagattacc
atcggaatccacacgggagaagtggtgacaggggtcatagggcagcggatgcctcgttac
tgcctgtttggaaacacggtcaacctgacgagccgcaccgagacaacgggcgagaagggg
agaattaacgtttcagagtatacctacaggtgtctgcagtcggaggagaatgcggaccct
cagtttcacctggagtaccgcggtccagttgctatgaagggtaaaaaggaaccgatgaaa
gtgtggttcctgtcccggaagagcgccgaggctgaagcgtga

DBGET integrated database retrieval system