KEGG   Scleropages formosus (Asian bonytongue): 108924517Help
Entry
108924517         CDS       T04919                                 

Gene name
suclg1
Definition
(RefSeq) succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00020  Citrate cycle (TCA cycle)
sfm00640  Propanoate metabolism
sfm01100  Metabolic pathways
sfm01200  Carbon metabolism
Module
sfm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sfm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    108924517 (suclg1)
   00640 Propanoate metabolism
    108924517 (suclg1)
Enzymes [BR:sfm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     108924517 (suclg1)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     108924517 (suclg1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 108924517
NCBI-ProteinID: XP_018591463
Position
16
AA seq 324 aa AA seqDB search
MSHSRLFARLLLKQNGVRHCYTGTRNNLYINKDSKVICQGFTGKQGTFHSQQALDYGTRL
VGGVSPGKGGKTHLGLPVFNSVKEAKESTGADASVIYVPPPFAAVAILEAVDAAIPLVVC
ITEGIPQQDMVKVKHRLLRQSATRLIGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRS
GTLTYEAVHQTTQAGLGQSLCVGIGGDPFNGTNFIDCLEVFLNDPKTEGIILIGEIGGDA
EENAAEYLKQYNTGDKAKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGAKEKIAALQSAG
VVVSMSPAQLGSTMFKEFEKRKML
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtctcacagtaggctgtttgcccggctgctcttaaagcagaacggagtccggcactgt
tacaccgggacgagaaacaacctgtacatcaacaaggacagtaaggtcatctgccaaggc
ttcaccgggaagcagggcacctttcacagccagcaggcgctcgactatgggacccggtta
gtgggcggagtctctcccggcaaaggcggtaaaacccacctggggttgccggtcttcaac
tctgtcaaggaggcgaaagagagtacaggcgcagacgcctctgtgatctacgtgccccct
ccgtttgcggcggtggccatcctggaggctgtggacgcggcgatccctctggtggtgtgc
atcacggaaggcatcccccagcaggacatggtgaaggtgaagcacaggttgctgcggcag
agcgccacccgcctcatcgggcccaactgccccggcgttatcaatcctggagagtgtaaa
attggaatcatgcccggccatattcacaagaaaggacgaatcggcatcgtgtccaggtcc
gggactctgacgtacgaggcagttcatcagaccacacaggctggactgggacagtccctg
tgtgttggaatcggcggagacccctttaatgggacgaacttcatcgactgcctggaggtg
tttctgaatgaccccaagacggagggcatcattctgattggggagatcggcggcgacgca
gaagagaatgcagccgagtacctcaagcagtacaacaccggtgacaaagccaagccggtg
gtgtccttcatcgcaggcttgacagctcccccaggcaggaggatgggccatgcaggtgcc
atcatcgctggtggaaagggcggtgccaaagagaagatcgcagccctgcagtcagcaggg
gtggtggtcagcatgtcccctgcccagctgggcagtacaatgtttaaggaattcgagaag
agaaagatgctatag

DBGET integrated database retrieval system