KEGG   Scleropages formosus (Asian bonytongue): 108926608Help
Entry
108926608         CDS       T04919                                 

Definition
(RefSeq) septin-7-like isoform X1
  KO
K16944  septin 7
Organism
sfm  Scleropages formosus (Asian bonytongue)
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sfm04131]
    108926608
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sfm04812]
    108926608
   04147 Exosome [BR:sfm04147]
    108926608
Membrane trafficking [BR:sfm04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    108926608
Cytoskeleton proteins [BR:sfm04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     108926608
Exosome [BR:sfm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108926608
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 RsgA_GTPase AIG1 Ras AAA_16 Gtr1_RagA FeoB_N AAA_22 ABC_tran AAA_29 Roc Fez1
Motif
Other DBs
NCBI-GeneID: 108926608
NCBI-ProteinID: XP_018594906
Position
7
AA seq 446 aa AA seqDB search
MRWRSSPDELRCLPDDVSRVMETIRHQRNLEGYVGFANLPNQVYRKSVKRGFEFTLMVVG
ESGLGKSTLINSLFLTDLYSKDYPGPSQRIKKTVQVEQSKVLVKEGGVQLTLTIVDTPGF
GDAVDNSNCWQPVINYIDSKCEDFLNAESRVNRRLMPDNRVHCCLYFIAPSGHGLKPLDI
EFMKRLHDKVNVIPLIAKADTLTPEECQLFKKQIMKEIQEHKIKIYEFPDTEDDEDNKLI
RKIKEKMPLAVVGSNVVIEVNGRKVRGRQYPWGVAEEGIFVENGEHCDFTVLRNMLIRTH
MQDLKDVTNNVHYENYRSKKLAAVTCNGVDATKTKGQLTKSPLAQMEEERREHVMKMKKM
ETEMEQVFEMKVKEKKQKLKDSEAELERRHEQMKKNLEAQYKELEEKRRQFEEEKANWEA
QQRILEQQKLDASKTMEKNKKKGKIF
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgcgttggcggtcgtcaccagatgagttgcgctgtctccctgatgatgtctcccgtgtg
atggagaccatacgacaccagagaaatctggaaggctacgtgggcttcgccaacctcccc
aaccaggtgtacaggaagtcggtgaagaggggcttcgagttcacgctcatggttgtgggt
gaatctggactcgggaagtccaccctcatcaactccctcttcctcactgacctctattcc
aaggactaccccggaccctctcagcgcatcaagaagaccgtgcaggtcgaacagtccaaa
gttctggtgaaagagggtggagttcagctgactctcaccatcgttgacacccccgggttt
ggagatgccgtggataacagcaactgttggcagcctgtcattaactacattgacagtaaa
tgcgaggactttctcaacgccgagtcccgagtaaaccgaagactgatgcccgacaacaga
gtacactgctgcctgtacttcatcgctccgtctggccacggactgaagcccttggacatc
gagttcatgaagcgacttcatgacaaagtcaacgtcatacccctcatcgccaaggcagac
actttgacacctgaggagtgtcagctgttcaaaaagcagatcatgaaggaaattcaggag
cacaagatcaagatctatgagtttcctgacaccgaagatgatgaggacaacaagctcatc
cggaagatcaaggagaaaatgcccctggcggtggttggcagcaacgtggtcatcgaggtg
aacggccggaaagtcagaggacgtcagtacccctggggtgtggcagaagagggcattttt
gttgagaatggggaacattgcgactttaccgtgttacgcaacatgctcatcagaacccac
atgcaggaccttaaggatgtcaccaacaatgtccactacgagaactaccgcagtaaaaag
ctggcggcggtcacctgcaatggtgtagacgccacaaagacgaaaggccagctgaccaag
agtcccctggcacagatggaggaggagaggcgggagcacgtgatgaagatgaagaagatg
gaaactgaaatggaacaggtctttgaaatgaaggtcaaagaaaaaaaacagaaactgaag
gactctgaagctgagttggagcgtcgccatgaacagatgaagaagaacctggaggcccag
tacaaggagctcgaggagaaaaggcgtcagtttgaagaggagaaggccaactgggaggcg
cagcagcgcatactagagcagcagaagctggatgcctccaagaccatggagaagaacaag
aagaagggaaaaatcttttga

DBGET integrated database retrieval system