KEGG   Scleropages formosus (Asian bonytongue): 108926665Help
Entry
108926665         CDS       T04919                                 

Gene name
camk1d
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type 1D
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    108926665 (camk1d)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sfm01001]
    108926665 (camk1d)
Enzymes [BR:sfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     108926665 (camk1d)
Protein kinases [BR:sfm01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   108926665 (camk1d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Kdo APH RIO1 Tyrosinase 5_nucleotid
Motif
Other DBs
NCBI-GeneID: 108926665
NCBI-ProteinID: XP_029107621
UniProt: A0A1W4Z2X1
Position
5
AA seq 412 aa AA seqDB search
MARENGECAGGDSWKKQVDDINKMFEFKEVLGTGAFSEVVLAQEKATGRMFAVKCIPKKA
LKGKESSIENEIAVLRKIKHENIVALEDIYESPNHLYLIMQLVSGGELFDRIVEKGFYTE
KDASTLIRQVLDAVNYLHKMGIVHRDLKPENLLYFNPQDESKIMISDFGLSKMEGTGDVM
STACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKADY
EFDAPYWDDISDSAKDFISCLMEKDPTKRFTCEQALRHPWIAGDTALCKNIHESVSRQMR
KNFAKSKWRQAFNATAVVRHMRRLQLGSSMDSSHHASQSQNRNQSQNQNPAHIKSQSTDS
SSPARKECLPTSSAPCSLALATSSPAAGLTPGGEGQSRSRPSTVTVVNTGTK
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggcccgggagaacggcgagtgcgccggcggggactcgtggaagaagcaggtggacgac
atcaacaagatgttcgagttcaaggaggtcctggggaccggggcattctccgaagtggtc
ctggcccaggagaaggccacagggcggatgtttgctgtcaagtgcattccgaagaaggcc
ctgaagggcaaggaaagcagcatagagaacgagatcgccgtgctccgcaaaataaagcac
gagaacatcgtggcgctggaggacatttacgagagccccaaccacctgtacctgatcatg
cagctcgtttccgggggcgagcttttcgaccgcatcgtcgagaaaggcttctacacggag
aaggatgccagcacgctcatcaggcaggtcctggacgcggtcaactacctgcacaagatg
ggcatcgttcacagagacctcaagccagagaacctgctgtacttcaacccccaggatgag
tctaaaatcatgatcagcgactttggcctgtccaagatggagggcacaggtgacgtcatg
tccacagcatgcggcacaccaggatatgtggctccagaggtcctggcccagaaaccgtac
agtaaagctgtggactgctggtccatcggagtcatcgcatatatcctgttgtgtggctat
ccgccgttctacgacgagaacgactcgaagcttttcgagcagatactgaaggctgattat
gaattcgatgcaccttactgggacgacatctctgactccgcgaaggactttatcagttgc
ctgatggagaaggaccccacgaagaggttcacctgtgagcaggccctccggcacccctgg
attgctggtgacaccgcgctctgcaagaacatccacgaatccgtcagtcggcagatgagg
aaaaactttgccaagagcaaatggcggcaagccttcaacgccacggctgtggtgcggcac
atgaggcggctgcagctgggcagcagtatggacagctcccaccatgccagccagagccag
aaccgcaaccagagccagaaccaaaatccagcgcatatcaagagccagtcgacagactct
agcagcccggcccgcaaggaatgtctgccgacgtcctccgccccctgtagcctggccttg
gcgacttcctcacctgcggcagggctcacgccaggaggggaggggcagagccgctcccgc
ccgtccactgtcacggtagtaaacactgggaccaagtga

DBGET integrated database retrieval system