KEGG   Scleropages formosus (Asian bonytongue): 108927995Help
Entry
108927995         CDS       T04919                                 

Definition
(RefSeq) cytosolic phospholipase A2 gamma-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00564  Glycerophospholipid metabolism
sfm00565  Ether lipid metabolism
sfm00590  Arachidonic acid metabolism
sfm00591  Linoleic acid metabolism
sfm00592  alpha-Linolenic acid metabolism
sfm01100  Metabolic pathways
sfm04010  MAPK signaling pathway
sfm04217  Necroptosis
sfm04270  Vascular smooth muscle contraction
sfm04370  VEGF signaling pathway
sfm04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    108927995
   00565 Ether lipid metabolism
    108927995
   00590 Arachidonic acid metabolism
    108927995
   00591 Linoleic acid metabolism
    108927995
   00592 alpha-Linolenic acid metabolism
    108927995
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108927995
   04370 VEGF signaling pathway
    108927995
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108927995
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    108927995
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    108927995
Enzymes [BR:sfm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     108927995
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B
Motif
Other DBs
NCBI-GeneID: 108927995
NCBI-ProteinID: XP_029109348
Position
7
AA seq 616 aa AA seqDB search
MVKMNLEELHRSLSLDGSPRRPECRNRTIGGVGNTATSNGSALWWMLRLLGPLRTPLTSL
LLVQHHDTEFHENVRLSKSLNPKEEEYVKGRQAVVEKCLKDNGIKYKQEHVPVIAVLGSG
GGERAMVGLLGSLAQMAEEKLLDSITYLCGVSGSTWCMASLYEDPCWSLKVPTNKDKLME
RLSDGEFNISEMLDWLNEAVEDENYSLTDFWAATVVYRTVKKIDRHHLSEQKDRDTTNPY
PIYTAIDKGMKEDHQKTYPWFEVSPHEAGYTHVGAYVTTSLFGSQFEEGIVKKQTEEKDM
LYLQGLCGSALADVENNKTEIEKWLWNWIKKIFSVMTSEQSAANVDPVHQILNHLIQLYD
KYDDNDHGCSLLLDHLKEQPVQNRLMVPSVELLLKHAWTNLSPELRLKYISDLSIEICNS
LEDWFGSLSKTAKIITKTIVALCSWTWGTKFNFLHNYSVEGSPVALVSDEKRYLMDAGLL
LNSPYVAALRPERKVDLILSFDFSSDDPFQTIRQAADYCKEAGVPFPTVVIPAGEEDKPK
DFYVFKDGEKAPIVIHIPLFNTVSCGDNLEQWRNNYKTFQLPYDRKKIEEVLSISSLNVK
NNKQQIIAEIQAVCTD
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaaatgaatctggaagagctccatcgttctctttcgctcgatggctcccccagg
cggccagagtgcaggaaccggactataggcggtgtggggaacacggccacatccaacggg
agtgccctgtggtggatgttgaggctgttgggcccactgaggacgccactgacatcgctg
ctcttggtccagcaccacgatactgagttccatgagaatgtgcgtttgtctaaatccctc
aatccaaaggaggaggaatatgttaaagggagacaagcggtggtggaaaaatgtctaaag
gacaatgggattaaatataaacaggaacatgtccctgtcattgctgtcctgggctcagga
ggaggtgaaagggccatggtgggactgctgggctctttggctcagatggcagaggagaaa
ctgctggacagcattacctatctgtgtggagtgtcagggtccacctggtgtatggcatca
ctgtatgaagatccctgctggtctttgaaagtacccactaacaaggacaaacttatggag
agactctcagatggagaattcaatatatcagaaatgttggactggctaaatgaagctgta
gaagatgagaattactcactgactgatttttgggctgcgactgttgtttatcgtactgtg
aaaaagatagatagacaccatctctcagagcagaaagacagagacacaacaaacccatat
cccatctacacagccattgacaagggaatgaaagaagaccatcagaaaacatacccctgg
tttgaggtcagccctcatgaagctggatacacccatgtgggtgcctatgtgaccacgtcc
ctcttcgggagccagtttgaggaaggaatcgtaaagaaacagactgaggaaaaggacatg
ctgtatctgcaaggactatgcggcagtgcccttgcagatgtggaaaacaacaaaacagaa
atagagaaatggctctggaactggatcaaaaaaattttttcagtgatgaccagtgaacag
agtgctgcgaatgtggatcctgtacatcagatactgaatcatcttattcagctgtatgac
aaatatgatgataatgatcatggctgctctctgctactggatcatctgaaagaacaacca
gtgcagaaccgcctgatggttcccagtgtggaattactgctgaaacatgcgtggacgaac
ttgagcccagagctgagactgaaatatatttcagatctttccattgaaatctgcaattcc
cttgaggactggtttggttctttaagcaaaactgcaaaaataataacgaaaaccatcgta
gcgctatgtagctggacctggggcaccaaattcaactttctacacaactattctgtagaa
gggtccccagttgcattggtgtcagatgagaagcgatacctgatggatgcaggactcctg
ttgaactctccctatgtggctgccttacggccggagaggaaggtggacctcattctctcc
ttcgacttcagcagcgatgatcccttccagacaatcaggcaagcagcagattactgtaaa
gaggccggagtaccattccccactgtggtcattccagcaggagaggaagacaaacctaaa
gacttctatgtgttcaaagatggagaaaaagcacccatcgtcatccacattccgctcttc
aacactgtcagctgtggagacaacctcgagcagtggaggaacaattacaaaacatttcaa
cttccatacgataggaaaaagattgaggaggttctctccatctctagtctgaacgtgaag
aacaacaagcagcagatcattgcagagatccaggcagtgtgcacagattga

DBGET integrated database retrieval system