KEGG   Scleropages formosus (Asian bonytongue): 108928134Help
Entry
108928134         CDS       T04919                                 

Definition
(RefSeq) titin-like
  KO
K12567  titin [EC:2.7.11.1]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sfm01001]
    108928134
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sfm04131]
    108928134
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sfm04812]
    108928134
   04147 Exosome [BR:sfm04147]
    108928134
Enzymes [BR:sfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108928134
Protein kinases [BR:sfm01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   108928134
Membrane trafficking [BR:sfm04131]
 Others
  Actin-binding proteins
   Others
    108928134
Cytoskeleton proteins [BR:sfm04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     108928134
Exosome [BR:sfm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108928134
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 I-set Ig_3 ig Ig_2 Pur_ac_phosph_N fn3_2 V-set C2-set_2 Pkinase fn3_4 Receptor_2B4 Pkinase_Tyr Ig_5 Ig_4 SusE
Motif
Other DBs
NCBI-GeneID: 108928134
NCBI-ProteinID: XP_029112763
Position
12
AA seq 24391 aa AA seqDB search
MSTEVPTFTQPLQNIVALEGTTATLEARVSGVPVPEVSWFRDGQVLSMATLPGAHISCAD
GRAVLTIPAVTAAHSGRFSVRATNVAGQATSTAELVVTAETAPPTFIQKLQSMAVKQGSQ
ATLSVRVTGTPAPDVKFFREGTEIQSSSDFRLVQDGDQHSLLVAEAFPEDSGMFSVTATN
SSGKATCTAQLLVQGEEAPSSFQIMTTVVSSDQIFHKYQTSAIKAEDVVQSPTPAGEVMV
PPTIVVGLSNTTVTEGEAVTLECQVSGRPTPAVVWFREEYKIENSSDFRLSFENGRARLT
IREAFAEDSGRFSCTATSEAGTASTSCYLAVKVSEEAEMKEALSSTVSRQIATEAVHVAM
ETKKQTVSEVNGMLEHMESDTGTPPFFVTKPSVQRLVEGRSVAFECQVGGNPQPHVYWKK
GGVPLSNGYRHKISHDKDSGMCRLEISMMLADDAGHYVITARNRLGEASASAILLKEEEY
EALTKQQKMGFGKEITSVVREIKAMGAPSVMTGGYRMGHVATQKRTLQQTAVMKSRIIEQ
EFHISAFEERIIQEIELHIRKISYQELAAEDGEQMVMDVAENEAMEPVFLTPAKSQRITE
GAGVTFCCKMAGTPLPKVAWYKDGKRIRHSDHYQIEVQPNGEVSLHIPAVQPEDEGIYTA
FAANMKGNAVSSGKLQVEPSTAVVAQPYVPQPQRTIRSTSPPSVGHSVVSRLDENEEGEL
EKMYKPIFIMRPSSLKCSEGQTARFDVKVVGSPMPETFWFHNGNPVRNDNTHKMVVKEDG
IQSLIVVPATPEDSGEWVVVAQNRFGQSSISMNLTVEAKETLTRPKFTEKLKNISIKEGA
EIEFVVKATGNPIPDIAWLKSSDIISEYKYPNYRLEGTKGESKFKITAATGSDTAWYTAI
AVNKVGRDTTRFKVNVKVESSDFRPERRLIIPKGTYKAKDIAPPELEPLPLRYGLEQWEE
GDLYDKDKQQKPHFKKKLSSVRLKRFGPVHFDCRLTPIGDPTMTVEWLQDGQPLAAANRL
RMTNEFGYCSLDYEVAYSRDSGVITCRASNKYGSDQTSATLIVKDEKGLVEETQLPEGIK
GRHRIEEIERTAHEGAPTGVTDDEASEKTKPEIVLLPEPASVLEGGTARFRCRVTGYPAP
KVNWYLNKQLIRKSKRFRLRYDGIYYFEITDCKSYDSGEVKVTAENPEGVAEHCVKLEIK
QKEDFRSILRRAPELKSPETGGAPEQGGLPFKVIKADKPPEPSQPKETVKLKKAERIIHE
IAPEETEELKNKFKRRTEEGYYEAITALEMKPHKKDDSYEGMLKKRKGELLHWTKEVPKE
EKEEQGDRGTITVTRQEKIQLDPSMRAPKILDRILSQTIYEGEEAHFRVRVDGHPTPECL
WFKNGVALEKSNRVYWFWPEDSVCDLVIKDVTAEDSASIMVKAVSAAGETSSHTFLLVQG
KHVISFTQQLEDVIAKEKDTMVTFECETSEPFVKVKWLKNDVEIFSGDKYRMHFDRKVHF
LSVLTIDMDDAAEYTCAVSDADHIRTSARLTVEGAPLYIIKNLENVEVPESYTGKLECEV
SREDAEGIWYFEDMEISPSSKYIISSRRGYRSLVVKDVGKEDQGEYTFVTGDLMTTATMK
ITLRPVTILQGLSDLTISEGSNAVLEVKFSQENVEGTWFKDGEGISEAAHIHMLSDKHMN
KLVIEGATKDDAGVYTFVVADQNVSTSAKLTVQIISILTPLEDVATIEGTKAVLEAKISV
ADVTSVKWYHDDELLMPSERVQSIAKGSKQRLVFNRTFASDDGYYRLVVGRADTSCGLAV
ENIDIVKAMEDQVCLETEDVTFEVELSHPGIDVIWSFKNQQLKNDAKYKIQSDGKHYSLT
VVLSTKEEEGLYVFEAGEKSCSATLTVSGGAVTKVLEDVVVAESQTAILGCEVANPNAEG
RWLKDGQRLVFNDNIRSEELDFVRRLVIVITRPQDAGEYTYHVGNSVSAANLKVEAVKIK
KTLKNQMVTETHDAVFALELSHENVTGSLWTKNGVEIHSSDKFAFGIDGTLHSLTIRNCS
THDEAVYGFKLGKLFTTARLDIDTIKIVKKPKDVTCLVDGTASFDLTLTHDDIPVKWMFR
NTELMPGENCEIVSAKKMHKLTLKNVESHNAGEYTAAVGHLQCVSSLHVESVSVTKAMKD
TKVPETKTATFECEVSHSNVPFAWLKDGVEIEPSHRFRIAAEGKVHQLKILNVSQEDAAE
YTFICGSDGVSATLTVSGKTQIKERAPISLGYCEEEDTSSVPPSPKEVSSTTEAVPTVSR
GSQGGNVEGVPPAVLQPLAHSRLAETEMLVLVVERGTNYMSGAAEDDNVCEVAGGSRRAK
SPTVLLVVKPQEGRAEPTHQCVLELHLEEDGSSRPPSPQEILVEVEMRANKVEQHEGHME
ITAVPQNTVGNMSVDLSLGFLPGPHAENLFDFVQQETDDVTVAFELTEIPPRFIDPVCDT
EAPDCGNAESECSLVGRPAPAATWFNDGLRVPHNGQKYLCESDADKHLVQSLSASPCGSD
ACSCEAVDEATETLCSSSLHVVRSQAAPGTEGGNIAHPGGAEAASHMFHFDVGGSSAHGD
DASEIELELEFGSGAEEPQEGVRVVAKSEDHATSQRESLHLNIFSRATEGEKVRLDAKDS
DACSFRVPVSMSTEVPKLTPPPLPPPPPPGLGASEGSAPAPQDPADDAAAIPARKTKATE
GLNDTSALEGETVTLECQISGRPTPTIVWFREERKIENSSDFRLSFEKGRARLEIGEAFA
EDSGRFSCTATGEAGTASTSCYLTVHGNFEKNVKNNETTMKTEATAETQDREVLPPVVIS
DCNKQQAVVIKNFAPEKVWSSPKTVLSSSLEPVSVGLLGPLALEEGPVVAPVWTRVGRKL
TYSVEYRDFSLEKLGTLLAQSKAPQGSGPRVTVAANEARNSTDSSGLMVQTRPTPSPGDG
DRRRGLRPGGGGDKPPPDANPFGFQLKAVPLKFIKDVKDIVLQEAESIGSSALFECEVSP
STAITSWMKDGSSLRESPKYKFTSDGKDRKLAIIDVQLSDQGEYTCIAKLGNKEKTSMAR
LIVEELPVKFTKTLKEEMSVITGQPLYLTCELNKERDVVWKKNGEPLEAVPEKVTVNVIG
MQHSVTIQNMGKEDVAVYTCECGSIKTEANVTLLVQEIPLTIISPLRDQHTYEEEEARFE
CELSREAKSFRWLRESEELQASDKYEMLHDGTKHTLVVKSITKEDLVKYVFEAEGLISFG
RIISKGIRLEFIKPLTEVTVKERETAEFKVELSHEKVQVVWYKNDARVLPSKTVQISEEG
KMHTLTFRGVSMDDTSMIKVEAMGKTSEAMLNVIEGDPFFVTKLQDYTAVEKDEAVLVCE
LNKASAEVRWFKDNEEVTPSKNIIIRAEGTKRMLTIRRAEKKDAGEFTCDCGAEKTSAKL
SIEERDIKVMRPLYGVEVTEMESARFEVEISEEDVHGQWKLKGETLQPSPDCEIKEEGAR
HVLVLYNVRMDQAGAVDFQAANAKSSAQLRVKARKITMSRPLKDVTVTAGETAVFECELS
YEGIAVQWFLGSTKLEPSDRVVTQAKGKAHCLTLKDVKLAEAGEVKLTAKDFVAPAKLIV
NEPAVQFTKPLEDQTVEEESTAILECEVSRENAVVRWFRDGQEILKTKKHEIVAEGRKRR
LLIADCTPDDSKTYTCDSKDFKTSAFLSVEPPRVEFTKPLQDVEVKEKEPARFECEVSRE
NAKVRWLKDGCEIRKSKKYEVIVKGFQHILIINKTAFDDEAEYECNARTSKSSGILTVVE
EEASFVKNLFNMEGTEAESIKLICEVSKPSADVRWFKGDKELPEGGRYEHVVDGRKRMLL
IKNLCVEDGGEYSCRLPSSQTTATLKINELAAEFLTKPQSQRAVEGEKVEFVCTITKEAQ
EVRWFRAKTELVAGEKYDIISDGCRRALVIKECILEDKGSYSAVIGSTRATAELTVLEKL
RVITPIKDTEVIEGQEIVFNCEVNAEGVKAKWLKNEETLFESAKYAMLQKDTVFSLRIKD
AQKSDEAQYSVSLTNQRGEHTKSSAGLTVKAEELRFIEPLEDCETQEKKTATFTCKVNRT
NVTVKWMRGDQEITFSKRVVYRADKNKHTLTIRDCKMDDEGDYSAVVGSDRSTAELIISE
APTDFSSQLRDQTVTEFEDAEFTCELSKEKAEVKWFRNGRAIREGPRYHIEKEGKTCKLY
VRVCRPDDECEYTCAVGEMRTRARLFVEEIPVEIVRPPADVFERPGSDAVFEAELNKDRV
EVKWLRNNMIIVQGDKYQMISEGKVHRLQVCEIRPRDQGEYRILAKDKDARAKLELAAAP
QFKTTDQNLVTDAGKPFVMVVPFDAYPRAEGQWFFKDTSLPGQNVDTSTDRTEYRLKEPR
KSDQGRYKIVIQNKHGKSEAYINLEVIDVPGPVKNLNVVDTADGEVSLAWDEPESDGGSK
IVAYTVERRDVKRRTWTLATDRADCPEYCVGGLQRDNFYLFRVSARNRVGTGQPVETDKP
VQAKNKFDPPDAPQNVIVGSVNRFGATLSWEPPAFDGGSEITSYIIEFRDRTSVRWDVAL
ATKAKEHSATLTDVIENKEYIFRVKAENKAGVGKPSAATNPVKIMDPIERPSPPLNLDYS
EQTKTSVLLAWEIPLSNGGSPITGYIIEKCEDGSEKWLRCNARLCQDLSYKVTGLKQGTK
YLYRVSAENAAGVSDPHEQIGPLLADDPHVAPTLDLDAFKNGLEVFVPNPVAIRIPITGY
PLPTAKWSVGDKELVAGDRVSMGTRHKTAELIITPSARSDKGIYTVYLENDVATISGEIE
VNVIAAPSPPRDFKVSEVTRHHVHLMWEAPEHDGGSPVTYYQVEKREVSRKTWVKVASGI
EDLEYTVTDVIEGKEYLFSVAACNRCGPGEPVYLEEPVNVSSPATVPEAPENLKWRDKSA
SGICLLWEPPKYDGGAGIKGYIVEKCQRGTDKWEPCGDMVSDLKSQVTGLTEGQWYAYRV
RATNRLGAGKPCRATDEIQAVDPKEPPEIQLDVKLLAGLTATAGSKIELPVKVLGKPEPK
ITWTRADLVLKADDRTSIETKPGRSVVTVAKTQRDDTGTYIVEAVNSSGRCTATVEVNIL
DKPGPPAAFDISDITNKSCILAWNPPRDDGGSEVTNYIIEKRASDSEQWQKLSSTVKQTN
FKACQLVALKEYVFRVFAENQYGIGTPAEHVPIVAKYSFDTPGAPTRVEPSDIAKDAVTL
KWYEPDEDGGSPVTGYWIERFDPETDKWIRCNKLPVLDTNFRVKGLPTKKKYRFRVLAEN
LAGAGKPSQETDQILVKDPIDPPWAPGKPFIKEIAKTSALLQWTRPEHDGGAKIESYVIE
LQKTGTEDWVRVAEGVSMTEHLLTGLMEKQEYSFRVRAINKTGESEPSDPSDPVICKERL
YPPAPPRWLEVVNVTKNSAELKWNAPDSDGGSPVTNYIVEKRDVRRKAWQAVDTTVKDTQ
YTVTPLNEGSLYVFRVAAENAAGQSDYTELEDSILAKDTFTTPGPPYALTVLEVTKRHVD
LKWEAPKNDGGRPITKYVIEKKEKMATRWMKAGKTQGPERTYQVADVTEGMEVQFQVCAE
NEAGTGQPSEPTDVLTIQDPTSPPSVPLEVKISDASRQHISITWKIPEKHGGSPILGYHI
ELSEAGTEKWMRVNSRPVKELRYRVEEGIKPEKQYVIRIRAINAIGVSDPSEISDAVFAK
DPECIPTLDLKCQDVEVVEGGRLQLSVLYKGVPVPTASWKKDGAELKADDRVSLSCELSA
ACLEIPKCVCADCGEYTITLENKLGSATGTVKVKIIGLPGQCKEIVESEVTKNSCKLTWG
PPENDGGSPILHYVLERREANKKTYIPVMSGENQVSWTVKDLLMNLQYYFRVKAVNKVGA
GEFVEIRNPVITEDQKERPDPPINVEARDPSSQSVTLTWKAPENDGGSAIIGYILEKIEK
DGDRFQRCNEDPVPGFSYTLKGLTEGKEYQFRVRAENACGLSDPSHSTPLIKAVDPVDPP
KVSLKGGLQYGLSLKKGEEIKIDAFISGSPYPTMTWFRNDEVLKPGAVKKKQEKPVLRKK
KAKDAPPEPEEPYHPPIEERLSFDLSKRGETSIMVRDSIRSDHGTFLIKVENIHGSATAT
CDVNVLDKPGRCLNFAFEDIRNNSVTCKWDPPEDNGGSEILNYILEKKDSSKDDTAWVTV
TSASKGCSCPVTKLIEGKEYVFRVTAENKFGSGYPCYSARLVAKNEFEPPDAPTMPRIVD
VSANSMLVTWHEPKDNGSPILGYWIERKEISSKNWTRVNHNLLNSLEVRAEGLNEGLTYV
FRVCAENLAGPGDFSVPTDSAIAQDPILPPGPPVPSIVDTTNSSIDVKWEPPLFHGGGDI
IGYHVEKMVLGDKDWSRATERPCRERKFTLTGLTEGADYIIRVIAVNESGDGVPGLTESV
TVKQPQEDPAVDFDDSVKNGVLIRVGESLRLPAHITGRPVPEVKWLKDEGELDKEHVVIE
TKGKTSILTIKNALRTDHGKYQVIGTNSSGTKTAETRVDVMDVPGLVSDLKAVTVTKRMV
LLHWSDPVDNGGSEIIGYVVERKDAKMHIFRQPLETSACKCEIVGLLEGEEYMFRVVAKN
KYGSGPPSDLGPILAVDPKGIPSAPDRFHYTERTKSTITLTWNPPRSDGGSPVYGYYVEK
RRQEGGEFEIANHQICRETTFTVENLKEHEMYDFRVRAVNEVGNGEPSQELTVTIQDDEV
APVITLLKQIKRNTLVVKDGEAVEIPAEVNGLPLPNIKWSKDGAVIEKSTETLLIETEEV
HRSKATTTLRIPITGRWDKGSYVLTASNHRGTANQYIKIVIFDCPLPPRNIVVSDIRAES
CYLTWDAPEDNGSSDITNYIIDKRDASKKKSDWENVTSCIVDRRYEVTKLEANATYQFRI
RAENKYGVSDGCESEKVVLRDPFGLPGPPGKPRIISCTRSSMMLTWDPPLDNGGSTIQGY
WLEKRERGGVYWSRVNRAPVTKPAVKGLEFNVLRLIEGIEYQFRVMACNAAGIGPHSENS
DFAFTADPCNPPSAPSSPDVTDKTNDSVTLTWRVPDKDGGSPILGYIIEVQDEGATEWKR
VNEPDKLILATKFTVQNLQENKQCRFRVVAVSAAGESDPSARSGAILVKEFEEEPKVTIE
VSAHQLTSCPAGSTIRIPATIHGLPVPKVTWEFDGTAKTEKKNNLHTLPVDSEVESTNTT
STVIIPQCKVSHDGRYIITAENKAGQKVVKVRVNVVDSPGPPRDLKVSDITRSSCRLTWK
PPISDGGERIMSYFIEKKTVEGKAWTKVNPACATQSFVVPDLNQGQDYLFRIRAENSYGM
GPFIETIQRTTARDPIYPPDPPTRVKIREVTKSTVTLTWKAPKNDGGAPVTHYIVERLYW
DTSGAQKESWRQCNRRDIEETTFKVENLNEGGEYEFRVKAVNVVGAGKPSSTAGPVVVKD
QTCAPSIELDEFMEVEQGSDISIIAKITGCPFPTLFWQKAPPHKAEDKSDVQYDEHVNKL
VSDNSCTLLICQGKRADTGLYTITASNSLGTASKEMRLNVLGCPGAPSAPIKIEEVSAEK
ITLSWLPPKDDGGSKVTNYVIEKRVANRKTWMHVTSEPKERIYTVENLMDGYEYVFRIRA
QNKYGVGDPLDSEPEKARDLYLPPGQCEKPTVSSVTHQSMTINWEEPEDDGGSPVTGYWL
ERKETTAKRWNRVTRDPIRPMPLGVSHNVTGLIEGSEYQFRVTAINAAGCGLPSAPSDPI
FAREPMSPPGPPTAKVTDWSKSAVHVEWIPPLKDGGSKIIGYVVEYKEEGQEEWKKAIDK
EVRGRKLAVTGLKELGLYRFRVRALNAAGLGEPGEVADVIEVKDRIIAPEVELDVSVKEK
IIIHVGGEFHILAHVSGKPAPQITWDRDGRNLPEGAVVETTATSSSVTHKKCTRKDRGTY
TLTAKNEGGETKKLVIVDVLDVPGPVGVPLSTENLTSDSCKLNWFFPDEDGGSPVTNFIV
EKREAEHKTWTPTFSNVTRQCAIIHNLVLGKSYFFRVAPENAVGMGPFTATTSDIVIRDR
ISPPERPEELEVTAVTKNYISLTWKPPKYDGGSDITMYILEARSIGKDKFVRLTKDKLLG
RKFTFEGLREGDAYEFRVSAVNEIGQGKYSFCTKQITCRDQLEPPTIEADFRDKVIVRVG
ESFALQGRYAGKPAPTITWTKDDHELKADNHIKFKKTSNTMCIYVIKAKREHSGRYCVLV
ENSTGSRKGICNVIVVDRPLPPEGPIVFEEVHRDHMVISWKPPLDNGGSEISNYVVEKKE
GSRDIWMNVTSATTKMTCKVPKLVEGKQYVMRVCAENMYGISDPLESEEMRAKDLFRVPG
APEQPIVKEVFRNSALVIWTRPRDGGKPITNYILEKKETSSKRWSRATRDPIFPDTQYRV
QDLTEGCEYEFRAMAENEMGVGDPSEPSKPIVAKDPTVLPSPPVLPEIVDKTKDSVSLSW
QLPRHDGKGKLFGYLIEYQKAGDEEWTKANETPESCPETKFKVCNLVDGQQYKFRVMVVN
AAGQSEPAYVRDLVTVHDRLEAPELLLDANMARDHLAMAGTNVVLSARIKGIPFPNVTWK
KNDADVPPRASTETTHVGSKLEIKNCLRSDCGNYTITVENPAGSKTATCTLLVLDKPSPP
RDLTISEVTSESAYLSWKEPKDDGGAVISHYIVEKRDVASDKWVPVCASSKKRTLMALYL
VEGVQYIFRVAAENQFGKSEYASSKKPIKAVDPLYPPGPPKNLHHVDADKTEVWLQWEWP
ERTGGSEVTAFVVEYQEEGAKDWITFKTVTKPECHVTGLEEGKTYRFSVKAQNAIGLSRP
DTTIPILCQGKLVAPSIEVDVKLIEGIVVKAGSTITLPATMTGIPTPIAKWVSDGKEMKT
EGNVNIETRDSSTILSIKDCTRKDSGEYILTVSNPAGSKTVALHITVLDVPSAPTGPVNI
LEVRPDHMVINWRPPKDDGGTPLMSYIVEKKDSKKPWEPWGVVSSGNISTQAKISRLEKG
REYIVRIRAENKIGIGESLESPPTVAKFMFDPPSSPGPPDAYDITENAMTLQWEEPLSDG
GSPISGYIVERREITGKWIRVNKTPVLDIRYRVSGLFEGNSYEFRIFAENIAGISEPSPP
SKPYKAKRAITKPGPPSNLKLKDWSKSYADIVWTKPTRDGGSPILGYIVECQKAGSAQWN
KINKDELIKLCAFRVPGLVEGTVYRFRVRASNKIGEGEPRELSETVLAKDILVPPEIIVD
AACRDMVTVRAGQNIVLAARVKGRPNPEIVWTKDARALGRDKRTEMNKNFPFVDMVIKEA
TRADYGKYAIQAKNSSGQAQATIIVNVLDIPGQCRNLKTTYVTKDSCMVSCENPEDNGGT
EITNYIIELRQPSQRTWSVVSNDCTKRLFKAPLMENCEYLFRVSAENKCGPGPTVETRTA
VLAVDPVEKPGEPENLQITDIGKTFVFLKWKKPDYDGGSRNLGYHVERKPKEADEWERLH
KGAIKETYFMADRCIENQIYQFRVQTKNEGGESDWVTTAETLVKEEIAEPVIDIKLAGVL
IVKAGDPIKIEAGLKGKPQPEVKWLKENDMGDINKSPRLHVDTGVDFSKFLLTASKREDS
GKYVITATNAGGSRTAHAVVNVLDKPGPIRNLKVSGISVDRCKLTWDIPEDEGGCDIMNY
IVEKCETKRMVWSVHSAAVIKNTANVTRLLEGNEYIFRVRAENKMGAGPAVESEAIVAKT
QFSRPGPPDPPEVTRIAKEEMTVSWSSPEFDGGKAITGYILERKEQHAIRWTPVTKSPIP
QTHMNVTNLIPNHEYQFRVKAENEIGLGDPSKPSRSVIAKDVLEPPGPPINLKVVDSTKT
SITLGWGKPVSDGGAPIIGYVVEIRPPPIKKSDEGWKRCNVAAQLTGTEFTITSLEEKLL
YEFRVSAQNQVGMGNPASLKDAVSPREILVDPEIDMDANLKKGLTIRAGCPIRLCATVRG
RPSPKVIWRRMGIDNVVRKGHVDLIDSMTFLLITDTTRDDSGKYSLTLISPAGEKAVFVN
VKVLDTPGPVTGLEVMDMTVTSCELTWSPPENDGGSEVTHYIVEKREIDRKTWGTVNNNV
SKTSLKIGNLVAGTEYYFRVTAVNQHGDGVPKATPRSYLASDPISKPDPPMKIDVLEISK
TSATLGWVKPLRDGGSKIDGYVVDYLIVIPPKEPVEGQPVVQEEKPEILWTPYSVVKDLT
IIVVGLKEGKKYKFRVAARNAMGCSLPTETKEAFEMKEQMLPPTVIMPDIITAKAGEKLR
VEALVSGKPPPVCKWKKGDSDVVPSSRLAMHKSQHCCVLIIKDVSRKDSGEYNLSVENSS
GKVDQGLKITIKDIPGPPQPPFVISDIDADACTLSWNPPLEDGGSNITNYVVEKSDVSRG
DWVSAMSSCGKTGCRLGKLVPGKEYIFRVRAENRFGVSDPIVSERMVAKFPFDVPGEPLN
CHITKVNKDCMFVAWDKPELDGGSPVTGYYIERKERNSLLWVKANDTVVRTTEYPCAGLI
EGLEYTFRVSAINRAGQGKPSKKTEFVTARTPVDAPGKPEVLDVTKNSVTLVWGRPKHDG
GSKIIGYYVEALRIPEDKWVRCNISSQNVPREEYTVTGLEEGSQYQFRIIAKTAVNLSRP
SEVCDPVLISAENVPPRIEIGISMKKMLPVKAGTTVCLEAEVFGKPMPKVMWKRNGETLK
PGERLLMKQKRHLFLLELMSVTKKDTGVYTILAENASGSKTEEINLTVLDIPGPPATVKF
GEVGNDRIQLIWEPPVADGGSPITNYIVDKRDTSRAEWAQVTAKIKDTECTVERLIEGRE
YQFRVRAENRYGAGEPILSNPIMAKNQFDVPGPCEPPVITNITKENMTVSWKEPVSDGGS
VVLGYVVEKQETKDIRWSRVNKKPITERTIEAKGLSEGAEYEFRVTALNKAGLGKPSDPS
NAVFAHDPLYPPGPPVSPKVVDTTNSTVSLTWTQPAKDGGSIILGYLVEVKRADGVDWIR
CNVPKNLQETKYTVTGLLENTEYQFRVTAVNKVGFGEPSEVPGKHAAKDVLVAPEADLSE
ELKQTLELRAGAPMRLHVPVRGHPTPKVTWAKMNANIKDRQSIVIKTTESDTMVYVEKVN
RYDAGKYVLNLESSSGMKMYTIIVKVFDTPGPPLNLMVKETSKESASISWDAPLIDGGSP
VKTYIVEKRDTERKAWSRVATDCATKSFIIQDLEPGRCYCFRVMAENEFGIGEPCETTDA
VRASEQPGAVKDFKALLVTKESCTLAWKKPISDGGSRIMAYVLEVKNGDDRWKVLMRSKN
MQYSAKDLIEGREYLYRIRAVNDAGEGPVKELKVVAKDIVVPPACELRELANLNYIAKEG
STVRLKIPITGKPAPSVTWTKGEDVTLTNIGRVSVESTAVHTTLLIRDCQRSDASKYTIT
LRNSAGARESHIFVRVVGRPGIPTGPVKFKEVTADGLTLKWGHPREDGGSEITNYVLEKR
DSITNMWVTVSTTVDTNSYRVMGLHEGTEYIFRVKAENKYGAGESLKSESIVAKHPFNVP
DAPPPPQVMSMWHDSAVLAWSDPRKTGGSPITGYHVEFKERNSLLWKRANKAALKLKDYR
ATGLTEGLEYEFRVMAINLAGVGRPSLPTQPLVALDPIDNPGKPDAISVTKSTVTLQWTE
PKYDGGHKLTGYIVEKRDLPAKVWTKANSVNVVDCAFTVTDLQEGCKYEFRIRAKNSAGA
ISPPSEPTDTIICMDEYEAPAIIIDSTMKEGLKVRAGDTIVITATSITGKPAPTAVWSKA
GKDFKPSDICQIETTPTSSTLSVKYASKKDSGEYTISASNPFGVKEENVKVQVLDVPGPP
GPLETSSVSAEKITLTWSPPHQDGGSPIKSYTLEKRETSRLLWTILADNLVDCHFVAHKL
IQGNEYIFRVSAVNQYGAGEATHSEPVKMVDSFGPPGPPSKPGIENVSQDSVTMSWKRPS
DDGGSDIIGYSVERKERKGTRWIRATKKLISELYYTVSGLLEGVEYEFRVTAENKAGFGE
PSESTHPVKTKGATYVPGPPVNPRITDTTKSTATFNWGKPHFDGGLDITGYIVEHKKEGS
EEWVKDTTTTGLKITEFVIQNLQLGGKYNFRVSAVNSEGVGEPAQVEEIIEIVDRTEVPD
FELDAELRRTLVVKAGASIRIFVPIKGRPTPEVTWMKEETSLKGRAHIDTTESYTLLVIP
DCNKHDAGKYIFTLENSAGKKTAHVIVKVLDTPGPPINLKTLDINKESITLQWEMPIIDG
GSKIINYIVEKREATRKAYTAVITKCPKCSVRVPNLAEGSEYYFRVRAENEFGIGEPVET
ADPIRASQAPSPPEKVNVVDITKNSVGLVWTKPKHDGGNRITGYVIEAQKKGSDQWAHVT
AAKTLDCIVKNLNENDEYTFRVMAVNNSGRSDPRDSRAVIIKEQTTEPAFDLRGLCQKLV
IAKAGDDIKVEILVLGHPKPSVSWKKDDQNLKLTQKLNVENTPTATILNITECSRNDSGQ
YSITAKNILGTVTETFTIKVHDIPGPPKGPLNLDKITPNYIIMSWDSPENDGGVPISNYI
VELRQTTSTTWVELSSAVIRTTFKAECISAGLEYQFRVKAKNRYGVGPPITSEAVVAAHP
FKVPGPPGTPHVVAFTRDTMTIGWNEPVLDGGSEVIGYHVERKERSSITWQRISKALVVG
NIFKSTGLEYGIAYEFRVFAENIAGMGKPSKPSEPMLALDPVDPPGQPVAAEITKSSVTI
QWTKPEYDGGFKITGYTVEKKDLPNGRWVKANFSNIVETSFTISGLTENASYEFRVSARN
LAGALSNPSEPSNPITCKDDIEEPRIMVDVKFKDVLLVKAGELFKLEADFTGQPLPSIVW
TKDEKEIENTMKLEMKTNDSSTILINKDSIRRDGGMFTLTATNVGGFAKHKFNVKVLDRP
GPPQGSLTITDITAESCVLTWLPPTDDGGAKIDHYIIEKRETSRLAWIHVASELQVKQIK
VTKLLKGNEYIFRVMAVNKYGIGEALESDPVIAVNPYMPPDPPDAPKVTTITKDSMILCW
EHPKNNGGSNIFNYIIERRDKTGVRWIRCNMKTVSDVIYKVSGLIEGHEYEFRIIAENAA
GLSAPSVPSSFYKASDAIFKPGPPGNPRILDTTKSSITIAWNKPLYDGGSEITGYIVETS
IPGEDEWAVVTPKDGLKATSFTIVNLKENQEYKINVSAVNCEGVGEATSVPGSPKAEERL
IPPEIDLDAELRKVINIRACNTLRLFVPLRGRPTPTVKWSRENEEPLTRATIESTSSFTS
VVIGNVNRFDSGKYIVTVANAAGSQTAFVNVRVLDTPGAPQNLKITAVTKESVSLSWDPP
LNDGGTKIKNYVIEKRESTRKAYATVNANCLKTSWTVDFLQEGCNYYFRVLAENEYGIGL
PIESVESVKVSEKPLPPGKITLQDVTKNSVTLTWDKPEHDGGSRIVAYVVEMQSKGSDTW
TQSVIVKSPEAVLTGLVQGQEYMFRVSARNEKGTSEPRQIGVPVIVRDLVITPSVKLLFS
TFSVLAGEDLTVDIPYVARPKATASWHKDGAPLKPTSRVNFEMTESQLCLIIKEACRDDV
GQYSIKLSNTAGETVTDIGIVVLDKPGPPCGPVKLDEVTSDSISLSWKPPEYDGGCTVKN
YIVEKRETSSTNWQIVAASLARTSIKAGRLKTDTEYQFRITAENRYGKSPALLSPCVVAQ
YPFKLPGPPGTPFVHASTKDSMTVVWNEPVIDGGSSILGYHLERKERKSVLWVKLNKTII
QDTRFKTTGLEEGMEYEFRVYAENIMGIGKASKVSECYVARDPCDPPGIPEATYITKNSI
TLRWTKPEYDGGSKVTGYIVEKKDLPEGRWLKANFTNVIETEYTATGLTEDQKYEFRVIA
RNAAGLFSDPSYSTGPITAKDEVDPPKISIDPQYSETLVISAGENFKIDADIHGKPLPAI
FWMKGEQELGNTVRREIKNTDHFTCLSVKEAKRTDGGEYILLLKNIGGEKSVRVNVTVLD
KPGPPTGPISVSGISSDQCTITWKPPQEDGGSKISHYVVERRETSRLIWTLVDPKVKMLS
LKITKLLEGNQYCFRVMAVNDYGVGEPLQSEPVNIKCPFVPPDAPKGVEISSVTKDSMVV
TWEAPTNSGGSPVTGYIIEKHDKEGVRWTKCNRDVVTELHFKVTGLLEGHCYEFRVSAEN
VAGIGEASTPSLYYRALDPTFKPGPPNNPKVIDVTSTSVFLAWGKPLYDGGCEIQGYIVE
ACEATSEEWKMCTPSTGTKHTRYEVGKLQEKHEYKFRVCAISKAGVGDHADVPGTTLVED
KSEGPDLDIAAEYMKVINVKAGSTLRLFILVKGRPAPKVKWEKVDGEMKERVQTEVTSSH
TCLVIDNVNRFDSGKYTVAAENASGSKSAVFSVRVLDTPSAPVNLKVKEITKESVTLTWE
LPVADGGAKIKNYIIEKRESTRKTYSAVATNCQKTTWKIEPLQEGCNYYFRVMAENEHGI
GLPAETIDPLKVSEVPQSPTKLSVVDVTRNSVSLAWEKPEHDGGSRILQYLVEMQPKGSD
KWTGCANVKTLEAVVSNLIHGEEYIFRVVAVNEKGKSDPRTLAVPVQAKDLVIDPDVRPV
FSSYTVQVEKDLKVEIPIAGRPKPNITWTKDGSPLKQTTRVNVINTENHTTINIKEATRD
DAGLYGIAVSNVVGQKEATIEIITLDKPGPPTGPVRFSEVNVQSITISWDPPKFTGGCQI
SHYIVQKRDTTTTTWENVSTSVVRTTLKVAKLKTGAEYQFRILAVNKYGKSYALESPCVV
AQYPYREPGPPGTPFVSSLSRNHMVVEWHEPIMDGGSSVIGYHLERKERNSILWTKINKS
LIKDTVFKTTPLEEGVEYEFRVYAENIVGIGRCSKVSEGYVARDPCDPPGNPEAIAISKS
SITLQWTKPEYDGGSIITGYIVEKRDLPDGRWMKANFTNVIETQFTVTGLTEDSKYDFRV
IAKNAAGTFSKPSYNTGPITAKDEVEPPRFSIDPEFSQIIVVNAGDSFKIDADVYGKPAP
MIQWFKGDKEIENTLRCEIKNTDSKALIVVKDAIRTDGGQYSLQLTNLAGTKTVPFNVKV
LDRPEPCEGPLNIIGTTSEKCTLSWHPPKHDGGSTVTHYIIERRETGRLAWTVVNNNCTV
NMFKVTKLLEGNEYVFRVMAVNKYGISEALESSPVIMKNPFVPPGSPQILDVTNITSNSM
TVCWAAPETDGGSEIITYIIEKKDRTGIRWTKCNRQKVTDVCFRVMGLSEDHEYEFRVSA
ENAAGDGEPSLPTSYYKASNPKFKPGPPVNVHVIDTTKNSILIAWGKPLNDGGSEIQGYI
VEICKAEDEEWTLCTPPTGLRVNKFEIGKLTENQEYKIQVCAINKMGVGEPTAIPGTAKP
EDKMEAPELSLDSELRKGIVVRAGGSVRIKIGLRGRPPPEISWSKDEGVLSDKVIIEKSL
NYTQLSMDNCDRNDTGKYIVKLNNSSGSVSEFVSVKVLDTPGAPLNFDVKDIKKDSVTLT
WEPPLTDGGAKIKNYVIDKRESTRKTFSNVAKCTKTSFKVENLAEGAMYYFRVMAENEYG
VGLPAELKNAVKASEVPLAVGKVTLTDVTKASVSISWEKPEHDGGSRITGYLIEMQPKGS
EKWNVATSTKTCEGTVSGLSSGHAYNFRIIACNEKGKSEPTPLAAPVIANDLNIEPSFKL
LFNSYNVKAGEDLTIEIPMMGRPKPQIDWMKDGETLKQTTRVTYVTGPASTTLMIKEANK
DDFGKYTVTASNNAGKVTEEIRIIVLDKPGSPTGPIKFNEVTNTSVTISWEPPEYTGGCQ
IKNYIVEKRDTTTTTWQVVSALIARTALKISKLKTGSEFQFRVSAENRYGKGPSLDSSAV
VVQYPYKLPGPPGTPFVRSLARDHMIVEWNEPVNDGGSAIIGYHLESKERNSVLWVKLNK
ILITDTVFKVNNLEEGNGYEYRVFGENIIGVGRSSKVSECYIARDPCDPPGTPEPISISK
NHIKLQWTKPEYDGGSKITGYVVEKRDLPEGRWTKASFTNVIETEFTVSGLTQDQKYEFR
IIARNAAGIFSEPSDSTGPITATDEIEPPRASMDPKYKDVVVVNAGETLALEADIYGKPP
PEVKWVRNGKEIDKSTAKMEVKTTVKRSVLIVKDCSKDDTGNYDITLSNVGGTKTIPIKV
KVLDRPGPPVAPLNISGVTANSCNLSWNEPSQDGGAKVSHYIIEKRETSRLSWTLAEPKV
EALSHKVTKLLTGEEYIFRVMAVNKYGVGEPLESEPVMARNPFKPPSAPSTPEAISVNKD
SMVIMWNPPEYTGGLEIQCYHLEKRDKDSARWTKCNREKLKELQFKVTGLAEGHFYEFRV
SAENEVGVGETSNPSLFYRACDATRPPGPPYHPKVTDHTNTSVSLAWAKPVDDGGAYIKG
YLVEMKETAQEEWTICTPATGIQATRYTVEKLKENSEYNFRICAINSEGIGEPADIHGSV
IAVDKAEAPEIELDADLRKVVSVRASGTLRLFVPIRGRPEPKVKWEKEDGSFTERVQVEA
TGSYTMLVIDNVNRFDSGKYILTLENKSGTKSEFINVRILDSPSAPINFAVRDVKKDSVK
LLWEPPLFDGGAKITNYIVEKRESTRKAYTAVTNNCTHTSFVIMELQEGGIYYFRVRAVN
EFGIGIAVETKDPVKVAQPPMPPGKVSVVDVTRNTATLSWEKPLHDGGSKIICYHVETQT
KGSDKWNVGATVQVLEATITGLMSGEEYHFRVIAVNEKGKSEPQELGVPVIAKDVQIEPT
INLLFNTYSVKAGKDLTIEVPFRGRPKPVVSWKKDGLPLMQTSSITILTSETSSKISFKE
TTRDHVGKYEIAVANTAGTKSAEIGVVVLDKPGPPSAMKVDEVTSESITLSWKPPEYDGG
CHISSYIVEKRDTNTTVWETVSSTLARTSIKISRLTHGSEYQFRIYAVNRYGKGPSIDSS
SITAEYPYKHPGPPSTPRVALATKAFMLVTWNEPVNDGGSTVLGYHLERKERSSVLWTKI
NRRLVKDTEFRVTGIEEGLFYEFRVYAENIVGIGKCSKTSEPVAARDPCDPPGQPTVTNI
TKSSISLSWTKPEYDGGAKITGYFVERRELPQGRWIRCNFTNIQETYLDVTGLIENQQYD
FRAIAKNAAGLFSAPSDCTGPITVKDDVELPRIMLDVKFRDVVVVKAGDTLKISADISGR
PLPVVSWAKDGKEMEPRQRIEISSTDTSTSVTVKDCVRRDSGQYLLTLQNVAGTTSFPIN
CKILDKPGPSAGPLEVSAITSAGCTLSWGPPQETGGAEITHYIVEKRETSRIAWTVVHAE
VKATTCKVTKLLKGNEYIFRVLGVNKFGTGEALESDPIKVLDPFTIPSTPLRVEIANVSS
EAMTICWEKPDSDGGSKISSYIIERREKSSMRWVRINKKPVTDNTFRATNLRAECEYEYR
VFAENAAGLSPPSDPSPLTKAQDPRFPPSPPTKPKVVDSTKDSMSLVWNKPLSDGGSAVI
GYSVEYKKTEDTVWAVAVPITRNTEFTVVGLCPGAEYVFRVKSISKIGVSDPSPTSEPHV
AKEREEEPVFDVDIEMRKTMIVKHGNSFTLTVPFKGKPVPSVVWEKDDINLKERASIDTS
DACTSLTAEKATRYDSGKYIVTLKNPLGTAALALSVNVLDSPGPPSQVKITDVTKESVTV
TWNAPENDGGDPVKNYHVEKREASKKAWINVTNNCRNLSYKVKDLQEGAVYYFRVIGENE
FGIGVPSEIKDGTMITEKPSAPTRIAVTAVTKDSVSLAWSRPEHDGGSKITGYLIDALEK
GQKKWVKCAVVKANQHVIRGLRENAEYFFRVRAENHAGLSEPKEMIVPMIVKDQIESPEF
DMKNFPRNTVYVRAGSNLTFEIPLTGRPLPKVTVTKDNVTVKVTKRFKFEVTPEGLLVNL
DESVASDSGKYDITASNQGGVAKSFVNILVLDRPGPPVGPVKIGETTETSVSLKWLPPVY
NGGSPVTNYIILKRETSTPTWTEVSSTVARNEIKVTKLTKGEEYQFRIKAENRFGISDHI
DSTSVTVKLPYTTPGPPSTPWVSFVSRESLTVCWHEPVFDGGNHVFGYHLQMKERSSALW
QKINKTPISGTQYRVKNICPGYIYEFRVAAENAAGIGKISKTSEEVLAIDACEPPANLRI
TDVTKNTVSLVWQKPPFDGGSKITGYVVEKRESPKGRWTKANFTNVIETNFIVSGLTQDE
SYEFRVFARNAVGSLSNPSLIAGPVKCIDVQGAPEIDLPPEYLDVVKFKAGKVIKIRVGI
IAKPLPTIEWSKDGKELVSSAQVSVESTTDSSGILIKDASRLNTGTYEIKIKNALGSASA
SIRVQILDKPGIPAGNIDFKSVTEDKITIAWEPPADDGGAPITHYIVEKRETSRVAWSIV
SEETEQRAVSAEKLVRGSEYVFRVRAVNKFGVGEPLESEPVIAKNAFVTPGQPTTPEVTA
ITRSTMIVVWDKPRVDGGSPILGYALEKRNKKNLRWEKVFREPVQETTQKVHNLTEGNEY
QYRVYAINKAGEGPFSDDSDFYRAADPIDPPDEPSKLKVVDSTKTSITLGWTKPEYNGGS
EVTSYVVEKRVAQETDWVVVSAKGEVRTTEYVVSQLKPDVEYLFRVSAVNCAGRGKPIEM
TEPVQAKDILEEAQIDLDVPMRTQYTVKAGADVEITVPIKGRPAPSATWKKGEENISTNL
RYDIHTTESSTILVIPQVTRNDTGQYNVQIENAVGEPKTVTVSVKVLDTPSACQKLLLKD
VTRGKVTLTWQPPLLDGGAPITSYIVEKRDSSKRSFSSVAKCTTTMYQIEELSEKCSYFF
RVRAENENGVGDPCDTAEPVKATETPGPVKNLSMKDSTKTSVTLQWSKPDYDGGSIITDY
IVEKRLQEEDVWSFAGTSKQCEYEVTKLKELSQMHFRVCSKNEKGQSDFTETGPIKVKDF
IIPPEADLSEYPDGEINVRLGHNVHIELPYKGKPRPSTEWLKDNLPLKESDQVRFKKTEN
KVTLMIKNLKKETGGKYTITLDNKACRRSFHIQVNALGPPSRPIGPIRFDEIRAESIIIS
WDQPADNGGGEVTSYTVEKRDTSQDDWKMVCSAVAGTTFKVTNLIKGTGYQFRVCAENRY
GISEPLVSHNVLAKHEFRPPGPPGKPFVYNVTNDGMTIQWDAPVYDGGSPVTGFHVEKKE
RNSVLWLKVNPLVITERTYRIIGLIEGLEYQFRVYAQNDSGYSRVGEASKYTTAVSPVDL
PGTPDYTDITSESVSLKWEPPKHDGGSKIVAYNVEKRQGQGRWLKCNFSDVHECQFTVTG
LSCGERYEFRIIARNAIGTVSPPSQSSGYILVRDESVAPNIEFSQDVSDGLTVKAGDKIR
VKVTITGRPEPKVTWFKDDKEIDKKSMVEIITAPRSSTLFVRDADRSHRGLYRVEATNNS
GTKKENIDIRVLDNPGEPIGPITFSNISEGKATLSWNLPENDGCSPITHYVIEKRETTKI
SWTLVTDECKACTYNATKLLKTNEYQFRVSAVNRFGNSRPLESDPIIAQMQYTVPDPPGT
PDSTSVTRDSITLSWEPPKSDGGNEIKYYIVERREKKSLRWVKILTRKPITEAAHRVTNL
TEGSEHEFRVMAVNDAGTSEPSNTSMLIKCCEPTTVPSAPSIVTITDSTNTSISLEWTKP
AHDGGLEILGYIIEKCKASSKEWEKVNTEYCTSTRFTATGLESGEEYKFRVCAVNKAGKG
DAREILEAVQAVDRLSPPEIEIDASFKQTHIIKNGGTAHLSIAFKGNPTPVATWKKVDGD
LGIMADVNTTENNSTLTIENCNRNDSGKYTLTLENSGGSKSIMFTIKVLDSPGQPGPISY
KDVSRGALTLTWDAPTNDGGARIHHYIVEKREASRRCWQEVSKSSDQMLRVSDLLEGVPY
FFRVSAENQFGQGEAFETVDPVIATAEPAPPKRLDIVDTTDSTATVAWLKPEHDGGSRIT
GYVVETKEKGTDKWVVGGHTKSLSTVIEGLAENTEYEFRVKAKNDAGFSEPREALASVII
KEPRIEPTADLSGITEQLITCKSGSTFTIDVPISGRPAPNVTWKLEEMRLKQTDRVSIKT
TRDRTTLTVKESMRGDGGKYYLTLENVTGSKTFTVTVNVTGRPNAPSGPIEVSSITSESC
VLKWEPPEDDGGTDITNYIVEKRESGSTAWQLVNSSIKRTTFQVTNLTKYMQYTFRVSAE
NRFGVSKPTESETVVAEHPYVPPSPPTRPEVFSVSGNAMSIRWEEPYHDGGSKVNGYWIE
KKERNTILWVRVNKVPCFECYYKVTELVEGLEYQFRVYAMNAAGLSKASEASKRMVAQNP
VDPPGKPEVTKVTRSTVSIKWSTPLNDGGSPIAGYIVERKPYTISGEGRWLKCNYTNITE
TNFTVTALGEGESYEFRVIARNTAGVHSLPSESTGSVTCKAEYSPPTAELDSKLLSETVT
VRAGGDLVLDAAIGGKPDPKAFWAKGQKELELCEKYFLQYTSTRAMAIIKFCDRDDSGIY
NLTVKNASGVKTAAVNVKVLDTPGPCEDKITISNVSEQKCTVSWKKPLQDGGDEITHYVV
ERRDTNRLNWVIMESECKSLSCVIGRMIKNHEYLFRLRAVNKYGPGVPLQSDPVVARNTF
TVPSPPGAPEIIVVGKDFATIQWLKPENDGGSEVTNYLVEKHERKSIRWTKVNRDLPITD
TTFKVTGLQTGNVYQFRVTAMNAAGDSEPSEVSLYAVCREATFVPAPPSIPRVSDTTKDG
VSLVWTRPTDDGGADIIGYVLEMQEVGAEQWTKAHEKNLKDTEYTVTGLSANKKYLFRVA
AINVNGTGDFSDPCTEVEPQERLESPDIDVPDELKKTICLRAGGSLHLVVTVTGRPTPVV
TWSKPGVVLQNRGFIEVAKNHASLIIDNVHRYDAGTYTIEAENSSGKKSATILVKIYDTP
GPPGALKIKDLTKDSAVITWDPPSVDGGAPVNNYIIERRDTSMRAYKTVTSKCHKTSYKI
TGLMEGLLYCFRVLPENIYGIGEACEISDAVLVCEVPMVPQKLDVVDVTKSTVTLAWEKP
LHDGGSRITGYIIEACRSGTDKWMKVATLKMTDFEHTVVSLNEKEQYLFRVRALNSRGAS
EPREIVTAVTVQEQRVMPKIDLSAFPHKSISVPAGKPIELGLPVIGRPPPLCSWYFGDVK
LKTHNRVKIESSAKYSKLTVSDTTIDDTGDYMLELRNAVGTATEVIKVIILAQPDEPRGP
IRFDEIDATSVTISWDPPERDGGSPITHYVVEMRDAHRPGWLPVSESVSRPTYKFARLTE
GDEYVFRVAAANRFGAGSFLQSDNVICKSAKTPPGPPGRPEVFDMSRDGMTLAWFPPDED
GGSKVTGYIIERKEVRSDRWVRVNKNPVTMTRYRSTGLIEGLEYEHRVTAINSRGIGKPS
LLSKPAVATDPVDPPGSPQNPRVVDTTKTSVSLAWSPPDEEGGSKVTGYLIEMQKVGSFN
WIKCNATPALICEYTLTQMPPGEEFKFRVLACNAGGTGEPAEVPGTIKVTEMLEPPTYDL
EAKYQEGIVVRQGAVIRLCVPIKGKPSPTCKWTKEGCDLTQRAMIANTEDLAELVIKEAN
KDDSGTYNLVLENKCGRKTAVIKVKVIGPPGPPEGPLRFDDIHAHSVKVSWKAPVDDGGS
PVLGYIVERRKVPKAAWYTVDTRVVDTSLVVKGLKENIEYEFKVTAENQFGTSKSLKSHE
TVTPKTPLCPPEPPSNPPEIVDVTKSSVALSWSRPKYDGGSRVSSYFVEHREASTDEWIR
HEKQITTTMYTLSGLTPEKEYHFRVIAKNDIGESEPGPASDSVICKDPFDKPSQPGEIDT
VIVTKDYISIRWERPECDGGKEILGYWVEYRMCGESSWKKCNTERTKDKEFTMGNLREAT
EYEFRVFAENETGISRPRRTATSIKTKLSVGDKPSLRKEIEEVTAKLGQSAILKCQIIGR
PLPEIRWYRHGKELMQTEKYAMTSDGRIHTLKVLANRQEDEGIYTCKAVNEAGEVETSGS
LVLEAPPQIHPEYPLKEIYYAGCGTSLRLHVVYIGRPEPKIMWFHNNKPLEPSDRVIIEN
TDHYTHLVIKDVHRKDAGKYKVWFRNVFGTVDTVLSVDIQDKPRVPVGPIVVDALLKNSV
IISWNPPADDGGAMITNYIVEKREETEGAPWQLVSSSVSGTSCRVPNLTEGAGYYFRVSA
QNRYGNSDPLEIPAVVIIKSQLDKPGIPQKLAVSGITKNSCIVSWRPPISDGGSKIKNYY
LEKRDLKSGQWVAVTTDEIHQTVYCVKGLVEGLQYEFRIKCENLGGESEWSEASAPITAT
GEIEIRAPAFKEELRNMSVKYKSKATLVCKVSGQPKPVVKWYKRGKEIHSEGEKIKIQEF
KGGYHQLVITAADEEDSTVYQIRVTNQGGSIAATVSLDVEVPAKIHLPKNLQEKEAVLAL
RGEVVSIKIPFSGKPDPVITWQKGQDLIDSNGHYQVIVTRSFTSLVFSNGIERKDAGFYI
VCAKNRFGIDQQTVEIDVADVPDPPRGIKASDVSRDSVTLNWCAPANDGGSKVTSYIVEK
CATTAEKWTRVAQSRDTRYTVINLFGKTSYQFRVIAENKFGQSEPSEPTGPVVTKEDKSR
VLNYDEEVDDVREVTAAKAPHSDTKNLHNKYMIAEELGRGQFAIVHRCTEVSSEKTYMVK
FVKVKGADQAVVKKEIATLNVARHRNFLCLHESFESPEELVMIYDFISGVDIFERIATPD
FELTERVIVNYIKQICEALAFLHSKSYGHFDIKPENIVYTTRKSTKIKIIEMGQARHLTP
GDTIKIQFTAPEYCAPEIHQHDLVSTVTDMWSVGVLAYVLLSGLNPFIAETNQQVIDNIS
NAEYSFDDEAFKKASLDALDFVDRLLTKDRKHRMTAAEALEHPWLKTNPEELSNTAIKTS
RHKRYYQTLVKKEWNVVVSAARVASGGTIRSQRGVTVGKVKIAPFEHGPVAGQVKHNATE
EGGDAKFICHIENYDSSTEVTWYCGVRQLEESDKYEISYEDGVAILSVKGVVRADDGTYR
CKVVNEYGEDSAYAELFVEGVRSYRDFFVGRTVKKAKRKVDTSRILQRPPEFTLPLINRT
AHIGEDVRFGVTITVHPEPRVMWLKSGQKITPGEDDRKYTFTSDKGLYQLVVHNVDFNDD
AEYTVVARNRFGDDSCKARLTVTPRPTPADTTLRPMFKRVLANLECREGQSVRFEVRVSG
SPILKWEKDGTPLSFGPQIEVVHEGLDYYVLHVKDTLPEDSGTYRVTATNSAGSASCQAT
LRVERVTHVKKEYESEADQKKRAEKEEIDKKVRLSQILSGTEVTPLIPVAQQALREAAVM
YKPALSKTDKAEIADRKEKEERKKRADEKRLRMPYNIPQPRVHAPTALEQDNEIKYFVPF
SDMKWYKKLRDQFEMPEPLEKHPQKRLKRIRLSRWDKFYEVPVARIKDHYVSRRIVLKAS
QDDLETVRPARYRTPSPESEAFYRPRRRSLGDLSDEELLLPVQDYLSMKRTEEERLRLEE
ELELGFSASPPSLSPVRFELSPLRHPPAKRRTYEEEDEEEEIQRYDSYRIPSKHEAGPSF
IDLRQRHEKATYRAPKQKQRVHEEREDHEILRPVATAQRLTTYKNELKRIEFEEKTSVSR
KERKVHISSAATEGLEPSTTYMPIHTPLTRPVSVPLRSPTPDKAQARSPSPIITETTPFK
PEESARVDFISRYEARKAALKTERKYEVVTQQPFSLDHAPRITVRMRSHRVPFGQNTKFT
LNVQAKPYAAIKWFHNGQEIQEGSKFQFSNISGVLSLQIFDCQLEDSGTYRVSCKNPKGE
ASDYATLDVTGGEYSSVSSHRKDEEPPTPFVPEMTKTEVYHVSSSKAAASSETHVEVKET
KSEIHESREHVQYEECVTSEKMEILEVTKLKEVTVHEEKVETVEVKKVEEVIVQEEVKPG
IPAKIVTKPESLTVSEGESAKFTCDCDGDPTPSVTWMHEGQIIVSSHRYQVTSLEHKSIF
EISSVETADEGNYIVVVQNSEGKQEAQFSLTIRKATPKEKAIASPPKVKSPEPRLKSPVS
PLAKSPEPRIRSPFGIKSPPKIKSPEPRVKSPVSPGAKSPEPHIMSPVETSSQPATKSPE
PRVKSPISPSPKSPEPRLKSPFEIKSPHALRSPEPRVKSPGSPGPKTPEPRIKSPVEIKS
PSRVKSPEPRVTSPLFPSPKSPEPRVKSPDPAAPPQRIKSPFAVKSPTPTKASATRPDFS
VTLKDVTASSDSIVKLSVKATGDPTPVFSWMKDEKIISQGGRYDIFEEDGFSYLEIYETE
VSDTGVYKCIASNSAGSCTSTCRVTIQAFKESKAIQIIDEKEAILSSHVKREVREQTVLT
EESSRRMVREEGFSSMTVHSAASMQEASFSSSRVAESQFESMSATSTSSVTSKSMSFTSM
MEEMTGQKVTSHSLQGTTKKIEALSEDVSVD
NT seq 73176 nt NT seq  +upstreamnt  +downstreamnt
atgtccacagaggtgccgacgttcacgcagccgctgcaaaacatcgtggccctcgaaggc
accacggcgaccttggaggcacgagtcagcggtgtgccggttccagaggtcagctggttc
cgtgacggccaggtgctgtctatggccaccctgcccggggctcacatctcgtgcgccgac
ggccgcgccgtgctcacgatccctgccgtgacggccgcgcacagcgggaggttctcggtg
cgagccacgaatgtcgccggacaagcgacgagcacggccgagctggtggtcacagctgaa
actgcgccgcccaccttcatccagaagctgcagagcatggcggtgaaacagggcagccag
gcgaccctgtccgtgcgcgtcaccggaacgccggcccccgacgtgaagtttttcagggag
ggaacagagatccagagctccagcgatttccgcctcgtgcaggatggagaccagcacagc
ctgctcgtcgccgaagcctttcccgaggactcgggcatgttctccgtcacggctaccaac
agcagcgggaaggccacctgtacggcgcagctcctggttcaaggagaagaagccccttcc
tcctttcagataatgaccactgtagtgtcatctgatcagatttttcacaaataccaaaca
agcgccataaaggctgaagatgttgttcagagtcccacacctgctggagaagtcatggtt
cctcccacaattgtggttggtttgagcaacacgacagtcaccgagggagaggcggtgact
ctggagtgccaggtctctggccggcccacgcccgccgtcgtgtggttcagggaggaatac
aagatcgagaactcctccgacttccgcctctccttcgagaacggacgcgctcgcctgacg
atccgcgaggccttcgccgaggacagcgggcgcttctcctgcacggccaccagcgaggcc
gggaccgccagcacgtcctgctacctcgctgtgaaagtgtcggaagaggccgagatgaag
gaagccctttccagcaccgtctccagacaaattgccactgaggcggtgcacgtcgccatg
gagaccaaaaaacagaccgtgtcagaggtgaacggtatgttggagcacatggagtcagac
acaggaacgccgccattctttgtgaccaagccttctgtgcagagactggtggagggcagg
agtgtggccttcgagtgccaggtcggcggtaatcctcagccccacgtctactggaagaaa
ggcggcgtaccgctgagcaacggctacagacacaagatttcccatgacaaggacagcgga
atgtgtcggctggagatatccatgatgctcgccgatgacgcaggacattatgtgattacc
gccaggaatcgactgggagaggcttctgcttcggccatcctgctcaaggaagaggagtac
gaggctctcaccaaacagcaaaaaatgggctttggaaaggaaatcaccagcgtagtgcga
gaaatcaaggccatgggtgccccttccgtgatgacaggcggttatcgcatgggccatgtg
gccacgcagaagaggacgcttcagcagacagcagtgatgaagagcaggattatagagcag
gaattccatatctctgcctttgaggagaggataatccaggagatcgaactgcacatccgt
aagatcagctaccaggagctggcggctgaggacggcgagcagatggtgatggacgtggca
gaaaacgaagctatggagccagtgttcctcacaccagcgaagagccaaaggatcacagag
ggagctggagtcaccttctgctgcaagatggcaggaactccgctgcccaaggttgcatgg
tacaaagatggcaaacgcattcggcacagtgaccattaccagattgaagttcagccgaat
ggagaagtcagtctccacatacctgcggtgcagcctgaggacgagggcatctacacagct
ttcgctgccaacatgaaaggaaacgctgtgagctcaggcaaactccaggtggagcccagc
actgcagtggtggcacagccttatgtccctcagccacagaggacaattcgttccacatcc
ccaccttctgtgggtcactccgtagtgtctagactggatgaaaatgaagaaggtgagctg
gagaaaatgtacaagcccatatttatcatgagaccctcttcactcaagtgctcggagggc
cagactgccaggtttgacgtaaaagttgttggtagtccaatgccggagaccttctggttt
cataacgggaatccagtgcgcaatgacaacacccacaagatggtggtgaaagaagacggc
attcagtcgctgatcgtggttcctgctacccctgaggactcaggagagtgggtcgttgtt
gctcagaaccgatttgggcaaagctcaatctccatgaatcttactgttgaggctaaagaa
acattaacgcgtcccaagttcactgagaagctgaagaacattagtatcaaggagggtgct
gagattgagtttgtcgtgaaggccactggaaacccaattccggatattgcttggctcaaa
agcagtgacatcatttcagaatacaagtatccaaattacaggcttgaggggacaaaagga
gaatcaaaatttaagatcacagctgccaccggctcagacactgcatggtacacggccatc
gctgtcaacaaggtgggaagagacaccacccgctttaaggtgaacgtcaaggtggagtcc
agcgacttcaggcccgagaggaggctcatcatccccaagggcacatacaaagccaaagat
attgcccctccggagctggagccgctgcctcttcgctacggtcttgagcagtgggaggag
ggtgacctctatgacaaggacaagcagcagaagccacatttcaagaagaagctctcctca
gtgaggctgaagcgtttcggacccgtacacttcgactgcaggctaacccccatcggtgat
cctaccatgactgtggagtggcttcaagatggccagccactggcagccgctaacagactg
cgcatgactaatgagtttggctactgcagccttgactacgaagtggcttattcgagagac
agcggcgtcatcacctgcagggcttctaacaagtatggatctgaccagacttccgctacc
ctcattgtgaaagacgaaaagggcctggtggaggaaactcaactgccggaaggcatcaag
ggaagacacaggattgaggagatagaacgcacagcccacgagggggctccgacaggtgtc
acagatgatgaagcatctgagaagacaaagcctgagattgtcctcctccctgagccggca
agtgtgctggaaggtggcactgccagattccgctgcagagttaccggatatccagcccca
aaggtgaactggtacctcaacaagcagctcattcgcaagagcaaacgattcaggctccgt
tatgacggcatttactactttgagattactgactgtaagtcgtatgattctggagaagtg
aaggtcacagcagagaatccagagggtgtcgctgagcactgtgtgaagctggagatcaag
cagaaagaggactttcgctccatccttcgtcgtgcacctgagctgaagagccctgagact
ggtggtgctcctgagcaagggggattgccgttcaaagtcatcaaggctgataaaccacct
gagccctcccagcccaaagagaccgtgaaactgaagaaggcagagcggatcatccatgaa
atagcccccgaagaaacagaggagctgaaaaataaattcaagcgccggacagaggaaggc
tattatgaagctataacggcattggaaatgaagccccataagaaggatgattcatatgaa
ggtatgctgaagaaaaggaagggggaacttcttcactggaccaaggaggtgcccaaagag
gagaaagaagagcaaggagacagaggaacaattacagttacgagacaagaaaaaatacag
ctggatcccagcatgagagctcccaagatcttggaccgcatcctgagccaaaccatttat
gagggtgaagaggcccacttccgagtcagagtagatgggcatccaaccccggagtgcctg
tggttcaagaatggagtggctctggagaaatcaaatcgcgtttactggttctggccagag
gacagtgtttgtgacttagtgataaaagatgtcactgcagaagactctgctagcatcatg
gttaaagctgtcagtgccgctggagagacttcaagtcacacatttctgcttgtacaaggc
aaacatgtcatcagcttcactcaacaactggaggatgtaatcgccaaggagaaggacacc
atggtgacatttgagtgtgaaaccagcgagccatttgtcaaagtaaaatggcttaagaac
gatgtggagatcttttctggagacaaatacaggatgcactttgacaggaaggtgcatttc
ctctctgtgctcactattgacatggatgatgctgccgagtacacctgtgcagtcagtgat
gctgatcacatcagaacctctgccaggctaactgttgagggtgccccgctgtacattatc
aagaacctggagaatgttgaagttcccgagtcctacactggaaagcttgagtgtgaagtg
tcacgtgaggatgctgagggcatctggtacttcgaggacatggagatcagtcccagcagc
aaatacataatttcctctcgtcgtggataccgcagtctcgttgtcaaagatgttgggaag
gaggaccaaggggaatacacctttgttacgggtgatctgatgaccaccgccacaatgaaa
attacattgagacccgtgacgatcttgcaagggctctcggacttgacaataagtgaaggt
agcaatgctgtactggaggtgaagttctctcaggagaatgttgaaggcacttggtttaag
gacggtgaaggtatctctgaagccgcacacatccatatgttgagtgacaagcacatgaac
aagctcgtcattgaaggggcgacaaaggatgatgctggagtgtacacttttgttgttgct
gatcagaacgtctccacctctgcaaagctgactgttcagatcatcagtattttgactccg
cttgaggacgtggccacaatagaaggcactaaggcggtccttgaggccaaaatctcggtt
gctgacgtaacctctgtgaagtggtatcacgatgatgagctgctgatgcccagtgagcgg
gtgcaatcgatcgccaaaggatcgaagcagcgcttggtcttcaacagaacctttgcctcc
gatgatggatactacagactggttgttggcagagcagacaccagctgtgggttggctgtc
gaaaatatcgacattgtgaaggctatggaagatcaggtgtgtttggaaactgaagatgtc
acctttgaggtggagctctcccaccccggcatcgatgtcatttggagcttcaaaaaccag
cagctcaaaaacgatgcgaagtacaaaatccagtcggatggaaagcattactctctcact
gtagtgttgagcacgaaggaggaggaaggcctgtacgtgtttgaagctggagaaaagagc
tgcagtgccacacttacagtttcaggtggtgcagttacaaaagtcctggaggatgtggtc
gtggcagaatcgcagactgccatcctggggtgcgaggtggccaacccgaacgctgaaggc
cgctggctgaaagatggacaacgccttgtctttaacgacaacatccggagcgaggaactc
gatttcgtccggcgcctcgtcatcgtcatcactaggccacaggatgctggcgaatacacc
taccatgtgggcaactccgtgtcagcggctaacctgaaggtggaagctgtgaagatcaag
aagacgcttaagaaccagatggtcaccgaaacacacgatgcagtatttgctctagagctc
agccatgaaaacgtgacaggatccctgtggaccaagaatggagtggagattcactcgagt
gacaagtttgcttttgggatagatggtacgctccacagcctgaccatccgtaactgctca
acacacgatgaggctgtctacggatttaaactcggaaagctcttcacgactgccaggctg
gacattgacacaatcaagattgtgaagaaacccaaagatgtgacgtgtctggtggacggt
acggcttccttcgacctcaccctgactcacgacgacattcctgtgaaatggatgttccgc
aacacagagctgatgcccggtgagaactgtgagatagtgtctgctaagaagatgcacaaa
ctgaccctgaagaatgtggagagccacaatgccggggagtacacggccgcggttggccat
ctgcagtgcgtctcctcgctacatgtcgagtctgtgagtgtcacaaaagcaatgaaggat
acaaaggttcccgagaccaagacggctacctttgagtgtgaggtttcacacagcaacgta
cctttcgcttggctgaaggacggtgtggagattgagccgagtcacaggttcaggatagcg
gcggagggcaaagtccatcagctgaagatcctgaacgtcagccaggaggacgcagcagaa
tacactttcatctgtggcagcgatggagtgtcggccactctgacagtgtctgggaaaaca
caaataaaggagagagcacccatatctctgggatactgtgaggaggaggacacgtcttct
gtcccaccgagcccaaaggaagtgagctccaccacagaagcggtgcctacagtctcccgg
gggagccaggggggaaacgttgagggcgtccccccagcagtccttcagcctctcgcacat
agtcgactcgctgaaaccgagatgttggtgttggtcgtggagagaggcacgaactatatg
agtggagctgctgaagatgataatgtttgtgaggtagcaggtggcagtaggagggcaaag
agccccactgtgctgctggtggtcaaaccccaggaaggaagggcagagcccacccatcag
tgcgtcttagagcttcatcttgaggaagacggttcatcaaggcctccttcccctcaggag
atcttggtggaagtagaaatgcgagcgaacaaggtggagcagcatgagggacacatggaa
atcacagcagttccacagaacacggtgggaaacatgagtgtggacctttccctcggcttc
ctgcccggtccccacgcggagaacctgtttgactttgtccagcaggagactgatgatgtg
accgtagcgtttgagctcacagaaataccaccgaggttcatagacccagtgtgcgacacg
gaggcccctgactgtggcaacgcagagtccgagtgctctttggtgggacgtcctgcaccg
gcagccacctggttcaacgatggtctcagagtcccacacaatggacagaagtatctctgc
gagtcagatgcagacaaacatctcgtgcagagtttgagcgcgagcccctgtggcagcgat
gcgtgcagctgtgaggctgtagacgaggcgaccgagacgctctgcagttcctctctccat
gtcgtccgctctcaggctgcgccaggaacggaaggagggaacatcgctcatcccggcggc
gccgaagctgcatcccatatgttccactttgacgttggaggttcatcggcacatggagat
gacgcttctgagatagagctggagttggaatttggctccggagcagaggagccgcaggaa
ggggtcagagtcgtggcgaagagcgaagaccacgcaacctcacagagggagtctctccat
ctcaacattttctctcgagcgactgaaggcgagaaggtccggctggatgcaaaggactcg
gatgcctgcagctttcgggtgcctgttagcatgtcgacagaggtgcccaagttgacgccg
ccgccgctgccgccgccgccgccgccgggccttggggcatcagagggtagtgccccagcg
ccacaggatcccgctgacgatgcggctgcgatccctgctcggaagaccaaggccactgag
ggcctgaacgacacaagtgcgcttgagggagagacggtgactctggagtgtcagatctct
ggccggcccacgcccaccatcgtgtggttcagagaggaacgcaagatcgagaactcctcc
gacttccgcctctccttcgagaagggacgcgctcggctggagatcggcgaggccttcgcc
gaagacagcgggcgcttctcctgcacggccaccggagaggccgggaccgccagcacgtcc
tgctacctcactgtccacggaaattttgaaaagaacgtaaagaacaatgaaacgacaatg
aagacggaggcgaccgcggagacccaggaccgtgaagttctccccccggtggtcattagt
gactgtaacaagcaacaggcagtggtaatcaagaactttgccccagagaaggtgtggagc
tctccaaaaacagttctcagctccagcttggagccagtgtctgtgggcctgcttgggcct
ctggcgctggaggaaggccccgtggtggctcccgtgtggacgcgggtgggccgcaagctg
acgtacagcgtggagtaccgcgacttctctctcgagaagctgggcaccctgctggctcag
agcaaagccccccaaggctcgggaccccgtgttactgtggctgcaaacgaggcccgaaac
agcacagactcttcaggattgatggtgcaaacgaggccaacaccatcccccggtgatggc
gaccggagaaggggtttgaggcccgggggcggaggagacaaacctccgccagatgccaac
ccctttggcttccagctcaaggccgttcctctgaagttcatcaaggacgtcaaggacatc
gtgctgcaggaggccgagtccattggttcctcagccctctttgagtgcgaggtgtcgcct
tccaccgccatcacctcatggatgaaggatgggagcagcctgagggagagccccaagtac
aagttcacctcagatggcaaggaccgcaagctagccatcattgacgtgcagctgtccgac
cagggggagtacacctgtattgccaaactgggcaacaaggagaagacctccatggccagg
ctcatcgtcgaagaactaccagtgaaattcacaaagaccctgaaggaggagatgtccgta
attacgggacagcctctgtacctgacgtgtgagctgaataaggagagggacgtggtgtgg
aagaagaatggagagccccttgaggctgtcccggagaaggtcacagtcaatgtcattgga
atgcagcacagcgtgaccattcagaacatgggcaaagaggacgtcgctgtgtacacgtgt
gaatgcggcagcatcaagacagaagctaacgtcacactcttggtacaagagattccgctg
accatcatcagtccgctgagagaccagcacacctacgaggaggaagaggctcgcttcgag
tgcgagctgtccagggaggccaagagcttccgctggctccgagagtccgaggagctgcag
gccagcgacaagtatgagatgcttcatgatggtactaaacacacgctggtggtcaagtcc
atcaccaaggaggacctcgtcaagtatgtctttgaagccgaaggcttgatatccttcggc
agaataatctccaaaggtattcgtctcgagttcatcaagcccctcacggaggtgacggtc
aaggagcgcgagactgcggagttcaaggtggagctctctcatgagaaggtgcaggtggtg
tggtacaagaacgacgcacgtgtgctccccagcaaaactgtgcaaatatccgaggagggc
aagatgcacacgttgaccttccgaggcgtctctatggacgacacatccatgataaaggtg
gaggcgatgggcaagacttcagaggccatgctcaacgtcattgagggagaccctttcttc
gtgaccaagctgcaggactacacggccgtggagaaggacgaagctgtgctcgtgtgcgag
ctgaacaaggccagcgccgaggtccgctggttcaaagacaacgaggaagtcacgccctcc
aaaaacatcatcatcagggctgagggcaccaagcgcatgctgaccatcaggagggctgag
aagaaagacgccggcgaattcacatgcgactgcggtgctgagaaaacctcagccaagctg
agcatcgaggagcgcgacatcaaggtgatgcgccccttgtacggcgttgaagtgaccgag
atggaaagcgctcgctttgaggtggagatctctgaggaggacgtccacgggcagtggaaa
ctcaagggagagaccctccagccatcgcctgactgtgagatcaaggaggagggagctcgg
cacgtcctcgtcctctacaacgtgcgcatggaccaggcgggagcagtcgacttccaggcg
gccaacgcaaagtcgagtgcccagctcagggtgaaagcgcgcaagatcaccatgtcgcga
cccctgaaggacgtgacggtgacggccggagagacggccgtcttcgagtgcgagctgtcc
tacgagggaattgcggtccagtggttcctgggcagcaccaagctggagcccagcgacaga
gtggtgacccaagcgaagggtaaagcccattgtctgaccctgaaagacgtgaagctggct
gaggctggagaggtcaaactgaccgcaaaggactttgtggctcccgccaaactcattgtg
aacgagccagcggttcagttcacaaagcctctggaggaccagactgtggaggaggagtcc
accgccatcctggagtgcgaagtgtcccgagaaaacgctgtggtcagatggttcagagat
ggccaggagatcctcaaaaccaaaaagcacgaaatcgtcgccgaaggccggaagagaagg
ctcctcatcgccgactgcacacctgacgactctaagacgtacacatgtgattccaaagac
ttcaaaacttctgctttcctgagcgtggaacctccacgtgtcgagttcacgaagcctctt
caggatgttgaggtcaaagagaaggaacctgctagatttgaatgtgaggtttctcgcgag
aatgcgaaggtgcgttggttgaaggacggctgtgaaatcagaaagagcaaaaagtacgag
gtcatcgttaagggtttccagcacattcttatcattaacaagacagcttttgatgatgaa
gccgaatacgaatgtaacgccagaacctcaaaatcgtccggcatcctcactgttgtcgag
gaggaggcttcctttgtgaagaacctgtttaatatggaaggcacagaagccgagagcatc
aagttgatctgcgaggtgtcgaagcccagcgctgatgttaggtggttcaaaggcgacaag
gagctccccgagggtggcaggtacgagcacgtggtggacggccgcaagaggatgctgctc
ataaagaacctgtgcgtggaagatggtggagagtacagctgcaggctgccaagctcacag
acgacagcgacgctgaagatcaacgaactggcagctgagtttcttaccaaacctcaaagc
cagagagccgttgaaggtgagaaggtggagtttgtctgcaccatcaccaaagaggcacag
gaagtcagatggttcagagcgaagaccgagcttgttgctggggaaaagtatgacatcatc
agcgatggctgcagaagagctcttgtgatcaaggagtgcattctggaagacaagggctcc
tactcggctgtcatcggctccacaagggctactgcggagttgactgtacttgaaaagctc
agagtgatcacacccatcaaagacacagaagttatcgagggacaggagattgttttcaac
tgcgaggtgaacgcggaaggcgtcaaagccaagtggcttaaaaacgaggagacgctgttt
gaaagcgccaaatacgccatgttacagaaggataccgttttctccctgaggattaaagat
gctcagaagtcagatgaagcacaatacagcgtcagcctgacaaaccagcgtggggagcac
accaagagctctgccggtctcactgtgaaagctgaggagttgaggttcatcgagcctctt
gaggactgcgagactcaggagaagaagacggccacctttacctgcaaggtgaacagaacc
aatgtgacagtgaaatggatgaggggcgatcaggagataaccttcagcaagcgcgtggtc
tacagggcagacaagaacaagcacacactgaccatcagggactgcaagatggatgacgaa
ggagattactcggcagttgtcggctctgacagatctactgctgagctcatcatcagcgag
gcccccaccgacttctccagtcagctcagagaccagactgtcaccgagtttgaggacgca
gagttcacctgcgagctctccaaggaaaaggctgaggtcaagtggttcaggaatggccgc
gcgatccgagaaggacccagataccacattgagaaagagggcaagacgtgcaaactgtat
gtgagagtgtgccgaccagatgacgagtgtgagtacacgtgtgccgtgggagagatgcgc
acacgtgccagactctttgtcgaagaaatcccagtggagattgtcaggcctcccgccgat
gtgttcgaacgacctggatcggacgccgtgttcgaggcagagctcaacaaagacagagtc
gaagtgaagtggctgaggaacaacatgattattgtccagggtgacaagtaccagatgata
agtgaagggaaggttcacaggctgcaggtgtgtgagatcaggcctcgggaccaaggcgag
tacaggatcctggccaaggacaaggatgccagagctaagctggagctggcagctgcacca
cagttcaagaccacagatcagaaccttgtgacggatgcaggaaagcccttcgtcatggtt
gtcccctttgacgcttacccccgtgctgaaggccagtggttcttcaaagacactagcttg
cctgggcagaacgtggacacgtctactgacaggacagagtacaggctcaaggaaccgcgg
aagtcagatcagggccgctacaagatcgtcattcagaataagcatgggaagagcgaggcg
tacattaacttggaagttatagatgtgcccggtccggtgaagaacctgaatgtggtggac
acggccgacggagaggtcagccttgcttgggatgagccagagagtgacggcggcagcaag
attgttgcctatacggtggaaaggcgtgatgtaaagcgtaggacatggacgttggccaca
gaccgcgctgactgccccgagtactgtgtgggcggccttcagagggacaacttctacctg
ttccgtgtgagcgcccgcaatcgtgtgggcaccggacagcctgtggagacggacaagcct
gtgcaggcgaagaacaagtttgaccctcctgatgcgccacagaatgttattgtgggcagt
gtgaaccggtttggtgccactctctcctgggagcccccagcatttgacggaggctctgag
atcacgtcctacatcattgagttccgcgacaggacttcggtgaggtgggacgtagccctg
gcaacaaaggccaaagagcacagcgcgacccttaccgacgtcattgaaaacaaagaatac
atcttccgcgtcaaagcggagaacaaggctggagtcggcaagccaagtgctgctacaaat
ccagtgaagatcatggaccccattgagaggccaagcccgccactgaacttggattactcg
gagcagactaagacctctgtcctgctcgcatgggagatacctctgagcaacggaggaagc
cccatcactggatacatcattgagaagtgcgaggatggaagtgaaaagtggctccgatgt
aatgcaagactctgtcaggacctaagctacaaggtgactggactgaaacaaggaacaaag
tacctttacagagtgtcggctgagaatgccgctggagtatcagatccacacgagcagatc
ggacccctcctggcagatgatccacatgtcgctcctacccttgaccttgatgctttcaaa
aacggcctggaggtcttcgttccgaacccggtggccatccgcattccgatcacggggtac
cctttgcccactgccaagtggagtgtgggcgacaaggagctggtggctggagaccgcgtg
tccatgggcaccaggcacaagaccgcggagctgatcatcacaccgagtgcacgctcagat
aaaggcatctacaccgtgtacctggagaacgatgttgccacgatctcgggagaaattgaa
gttaacgtcattgctgccccaagtccacccagggacttcaaggtgtccgaggtcacgagg
caccatgtgcacctgatgtgggaggcacctgagcatgatggagggagccctgtgacatac
taccaagttgagaaacgcgaggtgtcccgcaaaacatgggtcaaggttgccagcggtatt
gaggacctggaatacacggtgacagatgttatcgagggcaaagaatatttgttcagtgtt
gctgcctgcaaccgctgtggccctggagagcctgtgtaccttgaggaacccgtgaatgtg
tcttctccagccaccgtccctgaagcaccggagaacctgaaatggagggacaagtctgct
tctggcatctgccttctttgggagcctccaaaatatgacggcggtgccggaatcaagggc
tatattgtggaaaagtgccaacgtggcacagataagtgggagccctgtggagacatggtg
tctgatttgaagtcccaggtaacaggactcactgagggacagtggtacgcctacagagta
agagccacaaacagactgggtgctggcaaaccctgccgggccacagatgagattcaggct
gttgatccgaaagaacctccggaaatccagctggatgtgaaactgcttgccggtctgacc
gccacagccggatccaaaatcgaactgccagtgaaagtccttggaaaaccagaacccaaa
atcacatggaccagggctgaccttgtcctgaaagcagatgacaggacctcaattgaaacc
aaaccaggtcgctctgttgtgactgtggctaaaacccagcgagatgacacaggaacatac
atcgtagaggctgtgaacagcagcggccgttgtactgcaactgtcgaggttaacattctt
gacaagccaggccctccagctgcatttgacatctctgacatcacaaataagtcatgcatc
ctggcatggaacccgccaagagatgacggtggctctgaggtcaccaactacattatagag
aagagggcttcagatagcgagcaatggcagaagctctcctccactgtgaagcaaactaat
tttaaagcttgtcaacttgtagctctaaaggagtacgtcttcagagtgtttgctgagaac
cagtatggaattgggaccccagcagaacatgtgcctatcgtggctaaatattcctttgac
acccctggtgctcctactagagtggaaccatctgatattgccaaggatgctgtgaccctt
aagtggtatgaacctgatgaagatggtggaagtcccgttacaggatactggatagagagg
tttgaccctgagactgacaagtggatccggtgcaacaaactgccagtcctggatacaaat
ttcagagtgaaaggactgcccacaaaaaagaaatacagattccgtgtcttggctgagaat
cttgctggagcggggaaaccaagccaggagactgaccagatcttggttaaagatccaatt
gatcctccttgggcccccggtaagccattcatcaaagaaattgctaagacctctgccttg
ctgcagtggaccaggcctgagcatgacggtggagccaaaattgagtcatatgtcatcgag
ctgcagaagactggaactgaagactgggttcgtgtggctgagggtgtgtccatgacagag
cacttactgacaggactgatggagaagcaggagtactctttcagggtcagagccatcaat
aaaacaggagagagtgagcccagtgaccccagcgatcctgtgatctgcaaggagagactc
tatcctcccgctccaccacgctggctggaggtggtgaacgttaccaagaacagtgcagag
ctcaagtggaatgctccggattctgacgggggctcccctgtcaccaactacatagtggag
aagcgagacgtgagacgcaaagcgtggcaggcagtggacaccactgtgaaggacacacag
tacactgtcactcctctgaacgagggctccctgtacgtgttccgtgtggctgctgagaac
gccgctggacagagtgactacactgaacttgaggactccatcctggcaaaggacactttc
actactcccggaccaccatatgctttgactgtgctggaggtgaccaagagacatgttgat
ctgaaatgggaagctcccaagaatgatggcggtagacccataacaaaatatgtaattgaa
aagaaagagaagatggctacacgctggatgaaagcagggaagacccaaggtccagaacgc
acataccaagtggcagatgttacagaaggaatggaggtccaattccaagtctgtgctgag
aatgaggctggcactggacaaccgagcgagcccactgacgttctcaccattcaggatccg
acaagtccaccatctgttccgctggaagtgaaaatctctgatgccagtcgacagcacatc
tccatcacctggaagattccggaaaagcatgggggtagtcccatcctggggtaccacatt
gagctctcagaggcaggcacagaaaagtggatgagggtcaattcccgtcctgtcaaggaa
ctccgctacagagtggaggaaggcatcaaaccagagaaacaatatgtcataaggattcgg
gcaataaatgccattggtgttagcgatccctctgagatctccgatgccgtatttgcgaaa
gaccctgaatgcatcccaacccttgatctgaaatgccaggacgtcgaggtagttgaaggt
gggagattgcagctttctgtcctgtacaaaggagtgccagtgccaacagcatcctggaag
aaggatggagctgagctgaaggctgatgacagagtgtctctgagttgtgaattatctgca
gcttgcttagaaattcccaaatgtgtatgtgctgactgtggcgaatatacaatcacactt
gagaacaagcttggatcggccactgggacagtcaaagttaaaatcataggcttgccagga
cagtgcaaggaaattgttgaaagtgaagtcacaaagaattcttgtaagcttacttggggc
ccacccgagaacgatggtggcagccccatcctccactacgtcctggagcgcagagaggcc
aacaagaaaacgtacataccagtgatgtctggggagaaccaagtgagctggactgtgaag
gacttgctgatgaatttacagtactactttagagtcaaggctgtcaacaaggttggggct
ggagagtttgttgaaattcgcaaccctgtcatcaccgaggaccaaaaagagcgccctgat
ccacctataaatgttgaagctcgtgatccaagttcccagtctgtgaccttgacttggaaa
gcgccagagaacgatggtggctctgccatcataggttatattctggagaagattgagaag
gatggagacaggtttcaaagatgtaatgaggatcctgtgcctggcttctcttacaccttg
aaaggcctgacagaaggaaaggagtaccagttccgggtacgtgctgagaatgcttgtgga
ctcagcgatccttcccacagtactccactgatcaaggctgttgaccctgttgatcctccc
aaggtctctcttaagggagggttgcaatatggcctaagcctcaaaaaaggtgaagagatc
aaaatcgatgccttcatctctggatctccatacccaacgatgacatggttcaggaatgat
gaagtcctcaaaccaggggccgtcaagaagaaacaagagaagccagtcctgaggaagaag
aaagcaaaggatgcccctccagagccagaagagccttaccacccacccattgaagagcgc
ctctccttcgacctcagtaagaggggtgagaccagtataatggttcgtgactccattcga
agtgatcatgggacattcttgataaaagttgaaaacattcatggctctgcaactgcaacc
tgtgatgtcaatgtactcgataagcctggccggtgtttgaattttgccttcgaagacatc
aggaacaattctgttacctgcaaatgggatccacctgaggacaatggtggcagtgaaatc
ctaaactacatcctggagaagaaagacagcagcaaggatgacacggcatgggtcactgtg
acctcagcatcaaagggctgctcctgtccagtgacgaagttgattgaaggaaaggagtat
gttttccgtgtcacagctgagaataagtttggttctggatatccatgttactcagcacga
cttgtggctaaaaatgagtttgaacctcccgacgcacccaccatgcctagaattgtggat
gtttctgccaacagtatgctggttacttggcatgaacccaaggacaacggcagtcccata
ctgggctactggattgagaggaaggaaatcagcagcaaaaactggaccagagtgaaccac
aacttacttaactcactagaagttcgggctgaaggtctcaatgaaggcctgacatatgtt
ttcagagtctgtgctgaaaacttagctggacctggagatttcagtgtaccaacagattct
gccattgcacaagatcccatcttgcctcctggcccaccagtaccaagcattgttgataca
accaattcatccattgatgtgaaatgggagccccccctgttccacggaggtggcgatatt
attggataccatgttgagaagatggtgttaggtgataaagactggtctcgagccacagaa
agaccgtgcagggagcgcaagtttaccttaacaggcctcacagagggagctgattacatt
attcgtgtcattgcggtcaacgaatcaggcgacggagtgcctggcctcacggagtctgtc
acagtaaaacaacctcaagaggatccagctgttgactttgatgactctgtgaaaaacggc
gtccttatccgggttggggaatcactgaggctgcctgcacacatcactggtaggcctgtt
cctgaggtgaagtggttaaaagacgaaggagagcttgataaagagcatgtcgtcattgag
acgaagggaaagaccagcatacttaccattaagaatgccttaaggacagatcatggcaag
taccaggtgatcggcacaaacagcagtggaaccaaaactgcagaaacaagagtggatgtc
atggatgttcctgggcttgtgagtgatttgaaggctgtcacagtcaccaaaaggatggtt
ttactgcactggtctgatcctgttgacaatggcgggagtgaaatcattggctatgttgtg
gaaagaaaggatgcaaagatgcacatatttcggcaacctctggagacctctgcatgcaaa
tgtgagatcgttgggctgctcgaaggagaggaatacatgttccgtgttgtggccaagaat
aagtatggctccggccctccatctgatctgggtcctattcttgctgtggatccaaaaggt
atacccagcgcccccgacagattccattacaccgaaaggaccaagtcaaccattactctg
acttggaatccaccccgtagtgacggaggaagtcctgtttatggctattatgtggagaaa
cggagacaagaaggaggagagtttgaaattgccaaccaccagatatgcagggaaaccaca
tttacagtggaaaacctcaaagaacatgagatgtacgacttccgtgtcagggcggtaaat
gaagtgggaaatggtgagccttcgcaggaattaaccgtcacaattcaagacgatgaagtc
gctcctgtaattacattactgaagcagatcaagcgaaatacccttgttgtcaaggatgga
gaggcagttgaaatacctgcagaggtgaacggtctcccgcttcccaatatcaagtggtct
aaggatggagctgtcattgagaaatctactgagacactcctgattgaaactgaggaggtg
cacagatcgaaagctacaaccactctacgcatccccataactggcagatgggacaaaggc
tcctacgttctcacagcctcaaatcaccgtggaacagctaaccagtacataaaaatagtg
atttttgactgtccattaccaccacgaaacattgtggtttctgacatcagagcagagtcc
tgctatctgacatgggatgccccagaagataacggaagcagtgatatcacaaactatatt
attgataagagggatgccagcaagaagaagtcagactgggagaatgttactagttgcatt
gttgacagacgttatgaagtgactaaacttgaagccaatgcaacctaccagttcagaatc
cgagccgagaacaagtatggagtaagtgatggttgtgagtctgagaaggtcgtcctcagg
gatccatttggtcttcctggtccaccggggaagccaaggattatttcctgcaccaggagt
tctatgatgctaacctgggacccccccttggacaatggcggctctaccatccaaggctat
tggctcgagaagagagaacgtgggggtgtctactggagccgggtgaatcgcgccccagtc
acgaaacctgcagtcaaaggcctggagttcaatgtcttgcggctcattgaaggcattgag
taccagtttcgtgtgatggcctgcaatgctgcgggcataggcccacacagtgaaaactca
gattttgctttcacagctgacccatgcaatccgccaagtgcgccatcaagtcctgatgtt
acagacaaaacgaatgacagcgtgaccctcacgtggcgtgtgccagacaaagatggtggc
agtcccatcctgggctacatcattgaggttcaggatgaaggagcaactgaatggaaaagg
gtaaatgaaccagacaaactgatccttgcaacgaagtttactgtgcagaatctgcaggag
aacaaacaatgcaggttcagggtggttgcagtgagcgcggcaggcgagtcggatcccagt
gcaaggtctggtgccatcctcgtcaaagagttcgaagaggagccgaaggtaaccatcgaa
gttagcgcccatcagttaacgtcctgtccggctggatcaacaatcagaatccctgcaacc
atccatggactccctgttcctaaagttacgtgggagtttgatggcactgcaaagactgaa
aagaagaacaatcttcacacacttcctgtggattcagaggttgaatctacaaatacaaca
tcaacagtaataatcccacagtgtaaagtaagccatgatggcagatatatcataacagct
gaaaacaaagctggacagaaagttgtcaaagttcgagtcaatgtggtcgactcacctgga
cctccaagggatctcaaagtcagtgatattacaaggagttcatgcagactcacatggaaa
cctcctattagtgatggtggtgagaggatcatgagctacttcattgagaagaaaaccgta
gaaggaaaagcctggacaaaagtgaacccagcctgtgctactcagtcatttgttgtacct
gatctcaatcagggacaggattaccttttccgcatccgtgcagagaacagttatggcatg
gggccattcatagaaaccattcagaggacaacagctagagatcccatttatccacctgac
cctccaacaagggtgaagattagggaagtgacaaagagcactgtaactctgacatggaaa
gcacccaagaatgatggcggtgctccggtgacacactacattgttgaacgactttactgg
gacaccagtggggcacaaaaggagtcctggagacagtgcaacaggcgtgacattgaggag
accacattcaaggtcgagaatctcaatgaaggcggcgaatatgagttccgtgtgaaggct
gtgaatgtggttggtgctggaaaaccatcctccactgctggaccagttgtagtcaaagac
caaacatgtgcaccctctattgaacttgatgaattcatggaagtcgagcaagggtcggac
atcagcatcattgccaagatcacagggtgccctttccccacccttttctggcagaaggct
ccaccccacaaagctgaagacaagagtgatgtgcagtatgacgagcatgttaacaagctg
gtttctgacaacagctgcaccctgctgatctgccagggcaagagagcagacactggcctg
tacacaatcacagcaagcaacagtcttgggacagcctccaaagaaatgcgactcaatgtc
cttggatgccctggagcaccatcggcacctattaagattgaggaagtctctgctgagaag
atcaccctgtcatggctacccccgaaagatgatggcgggtcaaaagtcaccaactatgtc
attgagaagcgtgtggctaataggaagacctggatgcatgtcactagtgagcccaaagag
cgcatatacactgtggaaaatctcatggatggctatgagtatgtgttcaggatcagggct
cagaacaaatatggtgttggtgatccccttgacagcgagccagagaaggctagagatctt
tacttgccccctggccagtgtgaaaagccaactgtttcaagcgtgacccaccagtctatg
acaatcaactgggaagaaccagaggacgacggcggatccccagtgaccggctactggctg
gagcgcaaagagacgacggctaagcgctggaacagggtgactcgtgaccctattcgacct
atgcctcttggtgtatctcacaatgtgacgggtcttatcgaagggtccgagtaccagttc
cgtgtgacagccatcaatgcggcaggatgtggactcccaagtgcgccgtctgaccccatc
tttgccagagaacctatgtcccctcctggaccgcctactgcaaaagtgacagactggtcc
aaatcagctgttcatgtggaatggattccaccgcttaaggatggtggatcaaagatcatt
ggatatgttgttgaatacaaagaagagggccaagaagaatggaaaaaagctatagataag
gaagtaagaggcagaaaattagcagtgactggactgaaagaacttggactctacaggttt
agggttagggcattaaatgctgccggtcttggagaacctggtgaagttgctgatgtgatt
gaagtcaaggacaggataattgctccagaggtggagctggatgtttctgtgaaagagaag
ataatcattcatgttggaggtgaatttcacatcttggcccatgtgtctggcaagccggcc
ccccagatcacatgggaccgagatggccgtaacttaccagaaggagctgtggttgagacc
actgctaccagctcttctgttacacacaagaaatgtaccagaaaagatagaggaacttat
acattaacagctaagaatgaaggaggtgaaactaagaaactcgtcattgtggatgtgttg
gatgtgcctggtccagttggtgtaccactatccacagaaaatctaactagtgactcttgc
aaactgaactggtttttccctgatgaggatggcggctcacctgtcaccaatttcattgtt
gagaagcgtgaggctgaacacaagacctggactccaacatttagcaacgtcaccaggcaa
tgtgccattatccataatctagttcttgggaaatcctacttcttcagagttgcgcctgaa
aatgcagttggaatgggacccttcactgccacgacttcagatatcgtcattcgcgaccga
ataagtccacctgagcgtcctgaggaactggaagttacagccgtcacaaagaactacatc
agcttgacctggaaaccacctaaatatgatggtggctctgacatcactatgtatatcctg
gaagcccgttcaattgggaaggataagtttgtccgactcacaaaggataagctgctgggg
agaaagttcacatttgagggtctgcgagaaggtgatgcctatgaattccgtgtcagtgct
gttaatgaaattggccaaggaaagtactccttctgcactaagcaaatcacttgcagggac
cagcttgaacccccgactattgaagctgatttccgtgacaaggtcattgtgcgtgtcggc
gagtcttttgctctccaaggtcgctatgctggaaagccagctcctaccatcacgtggacc
aaggatgaccatgagcttaaggctgacaaccacatcaagtttaagaagacctccaacaca
atgtgcatctatgtgattaaagcaaagcgtgagcacagtggccgatactgcgtgctagtg
gagaacagcactggttcgcgcaaaggcatctgcaatgtcattgttgttgatcgtccacta
cctcctgaaggcccaattgtatttgaagaagttcacagagatcacatggttatttcctgg
aaacctcctcttgataatggtggttctgagatttcgaactatgttgttgagaagaaggaa
ggaagcagagatatctggatgaatgtaacatctgcaaccacaaaaatgacatgcaaagtt
cccaagctggttgagggaaaacagtatgtgatgagagtctgtgctgagaacatgtatggc
attagtgatccactggagtctgaagagatgagagccaaagatttatttagagtacctggg
gcacccgagcagccaattgtaaaggaggtcttcagaaactcagcacttgtgatttggaca
cgaccacgtgatggtggcaagcccatcactaactacattttggagaagaaagaaacctca
tcaaagagatggtcacgagccacacgggacccaattttccctgatacgcagtacagggtg
caggaccttactgaaggctgtgaatatgaattccgagccatggctgaaaatgaaatggga
gtcggtgaccctagtgaaccatctaaaccaattgttgccaaagatccaactgtgcttcca
agtccgccagtcctcccagaaattgttgacaagactaaggattctgttagtttgtcctgg
cagctgcctcgccatgatgggaagggcaaactctttggctatcttattgaatatcagaag
gctggtgatgaagagtggaccaaggccaatgagactcctgaatcatgtccagagacaaag
ttcaaagtctgcaatcttgtggatggacaacagtataaattcagggtcatggttgtaaat
gctgccggtcaatctgaacctgcctatgtcagagatctagtaactgtgcatgacagacta
gaggctccagagctcctgcttgatgccaatatggctcgtgaccacctggctatggctggt
acaaatgttgttttgagtgcccgcattaagggcataccattcccaaatgtcacgtggaaa
aagaatgatgctgatgttcctcctagagcaagtactgagactactcatgtgggaagcaaa
ctagaaattaaaaattgcctgcgctccgactgtgggaattacactataacggtagaaaat
ccagctggatcaaagactgctacatgcactctgcttgttttagataaacctagtccgccc
cgggatctgaccatttctgaagtgaccagtgagtcagcctacctttcctggaaagagcca
aaggatgatggaggtgctgttatttctcactatattgtggagaagcgagatgtggcttct
gataaatgggttccagtttgtgccagttccaagaaacgcaccttgatggctctgtacttg
gtggaaggcgtacagtatatatttcgtgttgctgctgaaaaccagtttgggaagagtgaa
tacgcttcatctaagaaacccatcaaggccgtggaccctctctatcctcctggtccacca
aaaaacttgcatcatgtggatgcagacaaaaccgaagtttggctacaatgggagtggcca
gaacgcactggtgggagtgaggtcactgcttttgtagttgaataccaggaggaaggagcc
aaagactggatcaccttcaaaacagttactaaacctgaatgccatgtcactggactcgag
gaaggaaagacctacaggttcagtgtgaaagcacaaaatgcaattggcttgagccgccct
gacactacaatacccatcctctgccaagggaaactagttgcaccaagtattgaagttgat
gttaagttaattgaaggcattgtagtgaaagctggaagtactataactcttcctgcaaca
atgacgggcattcccacccctattgcaaagtgggtcagtgatggcaaagaaatgaaaacg
gaaggcaatgttaacattgagacaagagactcctccacaatcctcagcattaaggactgc
acacgaaaggacagtggagaatatattctcacagtgagtaatcctgctggaagcaagaca
gtggctttgcacatcactgttctcgatgttccatcagcaccaactggccctgtcaatatt
cttgaagttagacctgatcacatggtcatcaactggcgccccccaaaagatgatggtggt
acacctttgatgagttatattgtggagaagaaggattcaaagaagccatgggaaccgtgg
ggagttgtgagctctggaaacatcagcacacaagctaagatttcacgtctggagaagggc
cgtgaatacattgtacgaattcgtgcagagaacaagattggtattggtgaatcacttgaa
agtccaccaactgtggctaagttcatgtttgacccacctagttctccaggcccaccagat
gcctatgacattacagaaaatgctatgactctgcagtgggaagaaccactttctgacggc
ggcagtccaatcagtggttacattgttgagcgcagggaaataacaggtaaatggattcgt
gtgaacaaaacacctgttttggatatcagatacagggtgtcaggactgtttgagggtaac
tcgtatgagttcagaatatttgctgaaaacattgctggcatcagtgaaccttctcctcct
tcaaaaccatataaggccaaaagagccatcaccaaacctggacctccaagcaacctcaaa
ctgaaggactggagcaagtcctatgcagacatcgtgtggactaaaccaacaagagatgga
ggcagccccatcttgggttacattgttgagtgtcaaaaagcaggtagtgctcaatggaac
aaaattaacaaggatgaacttatcaagctatgtgcatttagagttccaggattagttgaa
ggcacagtgtatagattccgagttagagcatcgaataagattggagaaggagaaccaagg
gaactgtctgaaactgtgcttgctaaagacatcctcgttccaccagaaattattgttgat
gctgcttgccgggacatggtaacagtccgagcaggtcagaatattgtccttgctgcccgc
gttaaaggacgacctaacccagaaattgtctggactaaggatgcaagggcattagggaga
gacaaacgcactgagatgaataaaaacttcccattcgttgatatggtcattaaggaagca
accagggcagattatggaaagtatgccattcaagcgaagaacagcagtggtcaggcacag
gcaactataatagtgaatgtacttgacattccgggacaatgtcgcaatctaaagacaact
tatgtgacaaaagactcttgtatggtatcatgcgagaatcccgaagacaacggaggcaca
gaaattacaaattatattattgagctccgtcagccaagccaaagaacttggtcagtggtc
tccaatgattgcaccaaacgtctttttaaggcaccacttatggaaaactgtgaatattta
ttccgtgtcagtgcagagaacaaatgcggtcctggaccaacagttgagaccagaacagca
gttctggcggttgatccagttgagaagcctggtgagccagagaatttgcaaattactgat
attggtaagacatttgtttttcttaaatggaaaaaacctgactatgatggtggtagccgc
aaccttggctaccatgtggaaaggaaaccgaaagaagcagacgaatgggagagacttcac
aagggagcaataaaagaaacatatttcatggctgatagatgcattgagaaccaaatatac
caatttagagtacaaacaaagaatgaaggaggcgagagtgactgggtgacaacagctgag
actcttgtcaaagaagaaatagcagaaccagtaattgatattaagttggctggtgttctc
attgtaaaagctggtgatccaattaaaattgaagctggtcttaaaggaaaaccccagcct
gaagttaagtggctaaaggaaaatgatatgggggatattaacaagagcccaagacttcat
gtggacactggtgtggatttctccaagttcctcttgacagcatcaaaacgtgaagacagc
ggtaaatatgttatcactgcaacaaacgctggtggaagccgcactgctcatgctgttgtg
aacgtgctggataagccaggtcccatcagaaatttaaaggtgtctggaatttcagtggac
cgatgcaagttgacgtgggatatccctgaggatgaaggtggctgcgacataatgaactac
attgtggagaaatgtgagacaaagagaatggtctggtctgtccattcagctgcagtcatc
aaaaacaccgctaatgtgacccgcctgctggaaggaaatgagtacatcttcagagtacga
gcagagaacaagatgggggctggtccagcagttgagagtgaggccattgtggccaagact
cagttcagcagacctggcccaccagacccaccagaagtcaccaggattgccaaagaagaa
atgactgtttcatggtcttctccagagtttgatggtgggaaggcaattacaggctacatc
ctggaacgaaaggagcagcatgcgattcgatggaccccagttacaaagagtccaatccca
cagacacacatgaatgtcaccaacttgatcccaaaccacgagtatcagttccgtgtcaag
gctgaaaatgaaatcggactgggagatcctagcaagccttcaagatctgtgattgccaag
gatgtacttgaacccccaggaccgccaataaatctgaaagtagttgatagcacaaagact
tcaatcacacttgggtggggaaaaccagtatctgatggcggtgcccccatcattggctat
gtggtggaaataagacctcctccaattaaaaagtcagatgaaggttggaagaggtgtaac
gttgctgctcagctgactggcactgaattcaccatcactagtttggaagaaaaattgctg
tacgagttccgtgtgtctgcacaaaatcaagttggcatgggcaatccagctagtctcaag
gatgctgtgtcacccagggagatattggtggatcctgaaattgacatggacgccaacctt
aaaaagggtctcaccatcagagctgggtgtcccatccggctctgtgccaccgtccgcgga
agaccttcccccaaagtgatctggagaaggatgggtattgataatgttgtgagaaaaggt
catgtggatttgattgacagcatgactttcctcttaatcactgacactacacgtgacgat
tctggaaaatattcccttacactcataagccctgctggggagaaggctgtgtttgtcaat
gttaaagtcctagacactccaggtcctgtaacgggccttgaagtcatggatatgacagta
acatcctgtgaactcacttggtctcctcctgagaatgatggtggcagtgaagtcacgcac
tacattgttgaaaagcgagaaattgacagaaagacctggggaactgttaacaataacgtg
tcaaagaccagcttaaaaattggcaaccttgtagctggcacagaatattacttcagagtg
acagctgttaatcagcatggcgatggtgtgccaaaagctaccccaaggtcctacctagca
tctgaccctatcagcaagccagacccaccaatgaaaattgacgtactggaaatctccaag
accagtgcaactttgggttgggtgaaacctctcagggatggaggatctaagattgatggt
tacgtagttgactacctaatcgtaattcctcctaaggaacctgttgaaggtcagcctgtg
gtacaggaggaaaaacctgagattttgtggaccccatattctgtggtcaaggacttgact
ataattgttgttggactcaaggagggcaaaaaatacaaattcagagtagcagcaaggaat
gccatgggttgcagtctacccacagaaactaaggaagcatttgaaatgaaggaacaaatg
ttaccaccaacagtgatcatgcctgatattataactgcaaaagcaggagaaaaactcagg
gttgaagcccttgtttctggaaagccaccaccagtctgtaaatggaagaaaggagacagt
gatgtggtcccatcgagtcgccttgctatgcacaaatctcagcattgttgtgttctcatc
atcaaagatgtctcaaggaaagacagtggtgaatacaacctttcggttgaaaacagcagt
ggaaaggtggatcaaggcttgaaaattaccatcaaggacatccctggtccaccacagcca
ccatttgtgattagtgatatagatgctgatgcctgcacactgtcttggaatccaccactg
gaagatggtgggagcaacatcactaattatgtagttgagaaaagtgatgtgagcagaggc
gactgggtctctgccatgtcatcatgcggcaagactggctgtagactgggaaagcttgtt
cctggaaaggagtacatcttccgtgtccgggcagagaaccgatttggagtttcagacccc
attgtgtctgagaggatggttgcaaaattcccctttgatgtcccaggtgaacccctgaac
tgccacatcaccaaagtcaacaaagactgcatgtttgtggcctgggataaaccagagctt
gatggaggcagtcctgttactggatactacattgaacgcaaggagaggaacagccttctt
tgggtcaaggctaatgatacagttgttcgaactacagaatacccctgtgctggcttgatc
gaaggtcttgagtatacctttagggtttctgccattaaccgtgctggacagggaaaacca
agcaaaaagacagagtttgtcacagcaagaacaccagttgatgcacctggcaaacctgaa
gtccttgatgtgactaagaattcagtcaccctggtgtggggccgaccgaagcatgacggt
ggcagcaagatcattgggtattacgtggaggctctaaggatccctgaagataaatgggtt
cggtgcaacattagcagtcagaatgtgcccagggaggagtacactgtcactggactggag
gagggaagccagtaccagttcagaatcattgccaagacggctgtgaaccttagcagacct
tcagaagtttgtgacccagtgcttatctctgcagaaaatgtgccaccaaggattgaaatt
ggaattagtatgaagaagatgctccctgtgaaggcaggaacaactgtttgtctggaagct
gaggtgtttggaaagccaatgccaaaggtgatgtggaagaggaatggagagaccctaaag
cctggcgaaagactgctgatgaaacagaagagacatctgttcctcttggagctaatgtca
gtcacgaaaaaagacaccggagtatacaccattctggcagaaaatgcaagtggttctaaa
acggaagaaattaatctgacagttctggacatacctggtccaccagctacagtcaaattt
ggggaagtgggaaatgatcgcatccagctgatctgggagcccccagttgcagatggtggc
tcaccaatcaccaactacattgtggacaaacgggacaccagcagggccgagtgggcacag
gtcacagctaagatcaaggacaccgaatgtactgtagagaggctcatagagggccgggaa
tatcagttccgtgtccgtgcagagaacagatatggcgctggtgaacccatcctgagcaat
cctattatggctaagaatcagtttgatgtccctggaccttgcgaacctcctgtcatcacc
aatataactaaagaaaacatgacagtaagttggaaggaaccagtcagtgatggcggttct
gttgttcttggctacgtggttgagaagcaggaaacaaaagacatcagatggtctagagtc
aacaagaagcccattacagagaggacaattgaagcaaaaggcctttctgagggagctgag
tatgagttcagagttactgctctcaataaagctggcttgggcaagccaagcgatccgtca
aatgctgtctttgcccatgatccattatatcctcctggcccgccagtgtctccaaaggtt
gttgacacgactaacagcactgtcagcttgacctggacacaacctgccaaagacggtgga
agcatcatcttagggtacctggttgaggtgaaacgagcagatggtgtagactggataaga
tgcaacgtacctaagaatctccaagagacaaagtacactgtaacaggattgcttgaaaac
actgaatatcagttccgtgtgactgctgtcaataaggttggcttcggtgagcccagtgaa
gttccaggaaagcatgctgcaaaggacgttctagttgctcctgaagcagatttgagtgaa
gaactcaagcaaaccctggagctgcgtgctggagccccaatgagacttcacgttcctgtg
agaggccatcccacacccaaagtaacttgggcaaagatgaatgctaacatcaaggacaga
cagagcattgtgataaaaaccacagagtcagacaccatggtgtacgttgaaaaagtgaac
agatatgatgcaggaaaatatgtactgaatctggagagcagcagcggaatgaagatgtac
acgatcattgtcaaggtttttgacaccccaggaccaccactaaatttgatggtgaaggag
acctcaaaggagagtgcttcgatttcttgggatgctcctttgattgatggtggaagccct
gtgaagacctacattgtggaaaaacgtgacacagagagaaaagcctggtctagggtagcc
actgactgcgcaacaaaatctttcataattcaggatctggagccaggcagatgctactgt
ttcagagtcatggctgaaaatgaattcggaattggggaaccatgtgaaaccaccgatgca
gtgagagcctcagaacaacctggggcagttaaggacttcaaggcattgctagtcaccaaa
gagtcatgcacccttgcctggaagaaaccaattagtgatggcggaagtcgcattatggca
tacgtgctggaagtcaagaatggtgatgacagatggaaggtgttgatgagatcgaaaaac
atgcagtatagcgccaaagatctcatagaaggaagagagtacttataccgcatcagagca
gtgaatgatgctggagagggtccagtgaaggaacttaaggtggtggcaaaggacattgtt
gttccacctgcatgtgaattgagagaactggcaaatttgaactacattgcaaaggaagga
agcacagtacgtctgaagatccccattactggcaagcctgctccttctgttacatggacg
aaaggggaggacgttactttgactaacattggccgagtgagcgttgagtccacggccgtc
cacacaactcttctgatccgtgactgtcaacgtagtgatgcctccaaatacacgattact
ttaagaaacagtgcaggggcaagggaatcgcacatctttgtcagggttgtgggaaggcct
ggaatacccactggaccagtaaaattcaaagaagtcactgcagatgggctcacattaaaa
tggggtcacccaagggaagacggcggatcagaaataactaactatgttctggagaagagg
gattccataaccaacatgtgggttacagtttctacaactgtggacacaaactcttataga
gtgatgggtcttcacgaagggaccgagtacatattcagagttaaagctgaaaataagtat
ggagctggagaaagccttaaatctgaaagcattgtggccaagcatcctttcaatgtacct
gacgcgccacctccaccacaagtgatgtctatgtggcatgattcggcggtactggcctgg
tctgatccgagaaaaactggaggctctccaatcactggctatcatgttgagttcaaggaa
aggaacagtttgctgtggaagagggcaaacaaagcagcactgaagctgaaagattacaga
gcgactggattaacggaaggacttgagtatgagttcagagtgatggccataaatctggct
ggtgttggaaggccaagtctgccaacacagcctttggttgccttggatccgattgacaac
ccgggtaaacctgatgcgattagcgttacaaaaagtactgtaacccttcagtggactgag
cccaagtacgatggtggacacaagctaactggctacattgtcgagaaacgtgatctgcca
gccaaggtctggactaaagctaacagtgtcaatgttgtagactgcgcgttcaccgtgaca
gacctacaggagggatgcaagtatgaattcagaataagggcaaagaattcagcaggtgcg
attagtccaccatcagagcctacagacaccattatctgcatggatgagtacgaggcacca
gccatcattattgattccactatgaaagaagggcttaaagtccgagctggtgacactatt
gtcatcacagccaccagcataactgggaaaccagcaccaacagctgtgtggtccaaagct
ggaaaagacttcaagccatcggatatctgccagattgaaaccactccaacatcctctaca
ttgtctgtcaaatatgccagcaagaaggattctggagaatacacgatttctgccagcaat
ccattcggtgttaaagaggaaaatgttaaagtgcaggtcttagatgttcctggtcctcct
ggtcctcttgaaaccagtagtgtttctgcagaaaagatcacactgacatggtcaccacca
catcaagatgggggctctccaattaaatcctacactcttgagaagagggaaaccagccgc
cttctatggacaatacttgccgacaatttggtggactgccattttgttgctcacaagctt
atccaaggcaatgaatatatattccgtgtttcagcggtaaaccaatatggtgcaggtgaa
gcaacacattcagagccagtgaaaatggtggacagcttcggtccacctggtcctccatca
aaaccaggaatagagaatgtgagccaagactctgtgaccatgtcatggaaaagaccgtct
gacgatggaggaagtgatatcatcggctacagtgttgaaagaaaagaacggaaagggaca
agatggataagagcaacaaagaagctaatttcagagctgtattatactgtgtcaggactc
cttgagggagttgaatatgaattccgtgtcactgcagagaacaaagctggctttggagaa
cccagtgaatcaacacatcctgtgaagacaaaaggcgcaacatatgtacctggtcctcct
gtcaacccaagaataacagatacaactaaatccactgctacattcaactggggcaaacct
cattttgatggtgggcttgacattactggatacatagttgagcataaaaaggaagggtcg
gaagagtgggttaaagacacaacaaccacaggccttaaaataactgaatttgtcattcaa
aatctgcaacttggaggaaaatataatttcagagtgagtgcagtgaactcagaaggagtt
ggtgaaccagcccaggtagaagaaattattgaaattgtggatcgcacagaagtcccagac
tttgaacttgatgcagagctaagaagaactcttgttgtcaaggctggagcttccatacgc
atttttgtgccaataaagggtcgcccaactcctgaagtcacatggatgaaagaagagacc
tcgcttaaaggccgggcacacattgataccacggagtcgtacacacttctagttatccca
gactgcaataaacatgatgcaggaaaatacatctttacattagaaaacagtgcaggcaaa
aaaactgcacatgtcattgtcaaggttttggatacacctggacctcccattaacctgaag
accctagatattaataaggaaagtattaccctccaatgggaaatgcctataatagatggt
gggtcaaagataataaactacatagttgaaaagcgggaggcaacaagaaaagcatacact
gcagtgatcacaaagtgcccaaaatgttctgtcagagttccaaatttggcagaaggctca
gaatattattttagagtgagagctgaaaatgaatttggcattggtgagcctgttgaaaca
gctgatccaataagagcttcacaggcaccatctcctccagagaaggtcaatgtagtggat
atcacaaagaattcagtaggtctggtgtggacaaaaccaaaacatgatggtggcaacaga
atcaccgggtatgttattgaagcacagaagaaaggttcagatcagtgggctcatgtgact
gctgcgaaaactttagactgtattgtgaaaaatctaaatgaaaatgatgaatacacattc
agggtcatggcagtgaacaattctggaagaagtgatcctcgtgacagcagagctgttatc
attaaggaacaaacaacagaacctgcatttgacttgcgtggtctttgccagaagttagtc
attgcgaaggcaggagatgacataaaagttgagattcttgttttgggtcatccaaaacca
tctgtttcctggaaaaaggatgatcagaaccttaaactgactcagaaactaaatgttgaa
aatacacctactgcaactatcctcaatataactgaatgctcaaggaatgacagtggacag
tactccatcacagcaaagaacatacttgggacagtgacagaaacattcactattaaagta
catgatattcctggccctccaaagggaccgcttaacttagacaaaattacccctaactac
attataatgtcatgggactcccctgagaacgatggaggagtgccaatcagcaattacatt
gttgaattacgtcaaaccaccagcacaacatgggtagagctctcatcagcagtaatccgt
acaacgtttaaagcagaatgtatttcagctgggcttgagtatcagttccgtgttaaagcc
aaaaacagatacggagttgggcctcctataacttcagaggcggtggttgctgcccatcca
ttcaaggttcctggtccaccaggaacgccacatgtagtggccttcactagagacaccatg
acaattgggtggaatgaacctgttttagatggcggaagtgaagtaattggataccatgtt
gaaaggaaggagaggagtagtattacatggcaaaggatcagtaaagccctagtggtagga
aatattttcaaatctacaggactcgaatatggaattgcttatgaattccgtgtgtttgct
gaaaacatagcaggcatgggaaaacccagtaagccatcagagcctatgcttgcccttgac
cccgtggaccccccaggccaaccagtagcagctgaaattactaaatcatcagtgactatc
cagtggacaaagcctgaatatgatggtggattcaagataacagggtacactgtggaaaag
aaagacttgccaaatggacgctgggttaaggctaattttagcaacatcgttgagacctcc
ttcaccataagtggactcacagagaacgcctcctatgaattccgtgtttctgcaagaaac
ttagctggtgccttaagtaatccatctgaaccatcgaatcccatcacctgcaaagatgac
attgaggagccaagaataatggttgatgttaagttcaaagatgtcctactggtaaaagcc
ggagaactcttcaaacttgaagctgactttacaggtcagccattaccatcaatagtttgg
actaaagacgaaaaggagattgaaaatacaatgaaattagaaatgaaaacaaatgattcc
tctacaatcttgattaacaaagattccataagaagagatgggggcatgttcacattaact
gctaccaatgtcggtggttttgccaaacataagtttaatgtgaaagttcttgataggcca
ggtccacctcaaggttcacttactattacagacatcactgctgaaagttgtgttcttaca
tggttgccaccaacagatgatggtggggctaagattgatcattacataatagaaaagcgt
gaaacaagtagacttgcttggatacatgttgcatcagagctgcaggtcaaacagatcaaa
gtgacaaagttgctaaaaggaaatgagtatatcttcagagttatggctgttaataagtat
ggaattggtgaagctcttgaatctgatccagttattgcagtcaacccatacatgcctccc
gatccgccagatgcccccaaagtaacaactatcaccaaggactcaatgattctttgctgg
gaacaccccaaaaacaatggtggaagcaatatttttaactatattattgagagaagagat
aagacaggtgtcagatggattagatgcaatatgaagacagtgtctgatgtgatatataaa
gtgtcaggactcattgaaggacatgaatatgaattcagaattattgctgaaaatgctgct
ggtttaagtgcaccaagtgttccaagttcattctacaaagctagtgatgctattttcaag
ccaggacctccaggaaatccaaggattttggacacaactaaatcatcaatcactattgca
tggaacaaaccactatatgatggtggctctgaaatcacggggtacattgttgaaaccagc
attcctggtgaagatgaatgggcagttgtaacaccaaaggatggtctgaaggccacatca
tttaccattgttaacctgaaagaaaatcaagaatataaaattaatgtttccgctgttaac
tgtgaaggggttggagaagctacatctgttcctggatcaccaaaggctgaagaaagatta
atcccaccagaaatagatctagatgcagaacttcgcaaggtcattaacatcagagcatgt
aacacacttagactctttgtacctttaagaggaaggccaactccaactgtcaagtggtca
agagagaatgaagaaccactcacaagagccaccattgagagtacgtcatcgtttacatca
gtggtgattggaaatgtcaatcgatttgacagtgggaagtacattgtcacagtggcgaat
gcagcaggaagtcaaactgcttttgtaaatgtcagagtgctggacactcctggtgctcca
caaaacctcaaaatcactgcagttaccaaagaatcagtctccctcagttgggatccccct
cttaatgatggtggtaccaagattaaaaattacgtcatagagaaacgagaatcaacaaga
aaagcatatgctactgttaacgctaactgtctcaaaacaagctggactgtagattttctg
caggagggttgtaactattactttagagttttagcagaaaatgaatatggcattggtctt
cctattgaaagtgtagagtcagtaaaagtttctgaaaagccccttcctccaggcaaaatc
acacttcaagatgtgacaaagaacagtgtaacgctaacatgggataaaccagaacatgat
ggaggcagtagaattgtagcctatgttgttgagatgcagagcaaaggcagtgacacctgg
acacagtctgtgattgtgaaatcccctgaagctgttctcactggacttgtgcaaggtcaa
gagtacatgttccgtgtttcggcaaggaatgagaagggaacaagtgagcctcgtcagatt
ggcgtgccagtcattgttagagaccttgtaattactccatctgtaaaattattgttctcc
acattcagtgttctggcaggagaagacttgacagtagacataccctatgttgctcgtcca
aaagcaactgcatcatggcacaaagatggcgctccactgaagcccacatccagagttaat
tttgaaatgacagaaagccagttgtgtctcattattaaagaagcttgcagagatgatgtt
ggccagtactccatcaagctttcaaatactgccggggaaacagtaactgacattggcatt
gttgttcttgacaaacctggtcctccatgtggcccagtaaagctggatgaagtcacatct
gacagcatctccttgtcctggaaacctccagaatatgatggtggttgcacagttaagaat
tacatagtggaaaagagagaaacttccagtacaaattggcagattgtggctgcaagtcta
gcaagaacatcaatcaaggcaggaaggctgaagactgatactgaatatcagttcaggatt
actgctgagaacagatatggcaagagccctgctctgctgtcaccatgtgtagttgctcag
tatcccttcaaacttccaggaccaccaggaacaccttttgtgcatgcttccacaaaggac
agtatgactgtggtttggaatgaacctgtaattgatggaggaagctctatattgggctat
catcttgaacgtaaagaaagaaaaagtgttctttgggtaaagttaaataagacaattatt
caggatacaaggtttaagacaactggacttgaggagggaatggaatatgagttcagggta
tatgcagaaaatattatgggtattggcaaagccagcaaagtgtcagaatgttatgttgct
agagatccttgtgatcctccaggtatccctgaagcaacttatatcacaaaaaattcaatt
acattaaggtggacaaagccagagtacgatggtggcagcaaagtcactggctacattgtt
gaaaagaaggatttgccagaaggacgttggttgaaagctaacttcactaatgttattgag
actgaatatacagcaacaggcttaactgaggatcagaaatatgagttccgtgtcattgca
agaaatgcagctgggctttttagtgatccatcttacagcactggccctattactgcgaag
gatgaagttgatccacctaaaattagcatagatccacagtattctgaaaccttagttatt
agtgctggggaaaacttcaagattgatgctgatattcatggaaaaccattgcctgcgata
ttttggatgaagggagaacaagagctcggcaacactgtacgtcgtgaaataaaaaacaca
gaccattttacatgtttgagtgttaaagaagctaaacgtacagatggaggtgaatacatt
ctgctcctgaaaaacataggaggagaaaagtcagtccgggtgaatgtcacagtgttagat
aaacctggtccaccaacagggcccatttctgttagtggtatatcaagtgaccagtgcaca
attacctggaaaccaccccaggaagatggaggcagcaaaatctctcactatgttgttgaa
aggagagaaacaagcagattaatttggactcttgttgatccaaaagtgaagatgcttagt
ttgaaaattacaaaacttttggagggaaatcagtattgcttccgtgtaatggctgtgaat
gattacggtgtaggtgagcctcttcagtctgaacctgtaaatattaaatgtccatttgtg
cctccagatgcacctaaaggtgttgaaatttccagtgtcactaaggactcaatggttgta
acctgggaagcacctactaatagtggtggcagtccagtcactgggtatattattgaaaag
catgataaagaaggtgtgagatggactaagtgtaacagagacgtggtgactgagttacac
tttaaagtcaccgggcttctcgagggtcactgctatgaattcagagtttcggctgagaat
gttgctggaatcggagaggcaagcaccccatcactgtactacagagccctggatcctact
ttcaaaccaggacctccaaacaatcccaaagtgattgatgttacgagtacctctgtcttc
cttgcatggggaaaacctttatatgatggtggctgtgagattcagggatacatagttgag
gcatgtgaagcaacatctgaagaatggaaaatgtgcacgccatcaacaggtaccaaacac
acaaggtatgaagttggaaaactacaagaaaaacatgaatataaattcagggtatgtgcc
attagtaaggccggtgtaggtgatcatgcagatgttccaggaacaactcttgttgaagat
aaatcagaagggccagaccttgatattgctgctgaatacatgaaggtgattaatgtcaaa
gctggaagcacactcagattattcattctagtcaagggaagaccagctccaaaagtcaaa
tgggagaaagtagatggtgaaatgaaggaaagggttcagactgaagttacaagcagccat
acctgccttgtgattgataatgtcaacagatttgacagtggaaaatatactgttgctgca
gaaaatgcaagtggttcaaaatctgcggttttcagtgtcagggtccttgacacaccaagt
gctccagtaaatctcaaagtgaaagaaattacaaaagagtctgtaacacttacctgggaa
ctgcctgtagcggatggtggagctaaaataaaaaattacataattgaaaaacgtgaaagc
acaagaaagacttattcagctgtagctaccaattgtcagaaaacaacctggaagattgaa
ccacttcaggagggctgcaattattacttcagagtaatggcagaaaatgaacatggaatt
ggcctccctgcagaaaccattgatcccttgaaggtgtctgaggttccacagtctcctacc
aagttgagtgtagttgatgtaacacgcaacagcgtttctcttgcttgggagaagcctgag
catgatggcggaagcagaatccttcaatatctggtggaaatgcaaccaaagggcagtgac
aaatggactggctgtgctaatgtcaaaacacttgaagctgttgtgagtaacttaattcat
ggagaagaatatatatttagagttgtagcagttaatgaaaaaggaaagagtgacccaaga
actctggctgttccagtacaggccaaagacctcgtcatagatccagacgtccggcctgta
tttagcagttacactgttcaagtggagaaagatctgaaagttgaaataccaattgctgga
cgccccaaaccaaatattacttggactaaagatggctcacctctgaaacagactacaagg
gttaatgtcattaacactgaaaaccataccaccataaacattaaagaagcaaccagagat
gacgctgggctctatggcattgctgtgtctaatgttgttggacaaaaggaggccacaatt
gaaataatcacactggacaaacctgggccaccaacagggccagtaagattcagtgaagtc
aatgtacaaagtatcacaatttcctgggatccaccaaaattcactgggggttgtcagatt
tcacactatattgtgcaaaagagagacacaaccacaaccacttgggagaatgtttcaacc
tcagtagtaagaactacattgaaagtggccaagttgaaaactggagcagaatatcagttc
agaatacttgctgtgaacaaatatggcaaaagttatgctttagagtctccctgtgtggtt
gctcaatacccatacagagagccaggtccacctggaactccatttgtatcctcactgtcg
aggaatcacatggtggtagagtggcatgaaccgatcatggatggaggcagcagtgtgatt
ggataccaccttgaacggaaggagaggaacagcattctctggacaaaaattaacaagtcc
ctaattaaagatacagtctttaaaaccactccattggaagaaggtgttgaatatgagttc
agagtctatgctgagaatattgtcggcataggtagatgcagcaaagtctcagagggatat
gtggcacgtgacccttgtgatccacctggaaaccctgaagctattgccataagcaaaagt
tcaatcaccctccagtggacaaagcctgaatatgatggaggcagtataattaccggatac
attgtggagaaacgagatcttccagatggtcgctggatgaaggctaacttcacaaatgtt
attgaaacccagtttactgtcactggcctaaccgaggactctaagtatgacttccgagtt
atcgcaaagaatgctgctggaacatttagtaagccatcttataatactggacctatcact
gcaaaagatgaagttgagccaccaagattttcaattgacccagagttcagtcagattatt
gttgtaaatgcaggagattcctttaaaattgatgctgatgtctacggaaaacctgcacca
atgattcagtggttcaagggtgacaaagaaattgaaaatacgttgcgatgtgagataaaa
aatactgactcaaaagcactgattgttgttaaagatgcaattagaactgatggtggtcag
tacagtctccagctcaccaacttagctggtaccaagactgttccattcaatgtgaaagta
ctggacagaccagaaccatgtgagggacccctgaacatcattggtacaacttctgaaaaa
tgtactctgtcatggcaccctccaaaacatgatggtggcagtactgttactcattatatc
attgagaggagggaaactggccgtcttgcatggaccgttgttaacaataactgcacagtt
aacatgtttaaagtgactaagctccttgaaggaaatgaatatgtattccgtgtcatggct
gtcaacaaatatggaataagtgaagcactagaatcatcaccagtaataatgaaaaatcca
tttgttccacctggatcaccacaaattctagacgttactaacattacaagcaattctatg
actgtgtgctgggctgcaccagaaacagatggtggaagtgaaatcattacctatattatt
gagaagaaagacaggactggaatcagatggacaaaatgcaatagacagaaagtcacagat
gtgtgcttcagggtgatgggtttgtcagaagatcatgaatatgagttcagagtttctgct
gagaatgctgctggagatggtgaacctagtctcccaacttcatattacaaagccagcaat
ccaaagtttaaacctgggccgcccgtcaatgtgcatgtgattgacaccacaaagaattcc
attttgatagcatggggcaagccacttaatgatggaggcagtgaaattcagggatacatc
gtagagatctgcaaagctgaagatgaggaatggactctgtgcacaccaccgactggcctc
cgagtgaacaagtttgaaattggtaaacttacagagaatcaagaatataagattcaggtg
tgtgccattaacaaaatgggagttggtgaaccaacagccattcctggaactgcgaaacct
gaagacaaaatggaagcacctgaactgagccttgactccgaactaagaaaaggaattgtg
gtgcgtgctggagggtcagtgagaatcaaaataggattaagaggacgtccacctccagag
atcagctggtctaaagatgagggagttttgtctgataaggtgatcatcgagaagagtctt
aactatacccaactttcaatggacaattgtgatagaaatgacactggaaaatacattgtc
aaactgaacaacagcagtggctctgtgtcagaatttgtgtctgtcaaagtacttgataca
ccaggagcacctctgaattttgacgtaaaagacatcaagaaagattctgtcactcttacg
tgggaaccaccgctgacagatggtggggcaaagatcaagaattatgttattgataaacga
gaatcaacaagaaaaacatttagcaatgttgccaaatgcaccaaaacaagctttaaggta
gaaaatcttgctgaaggagctatgtattatttcagagtcatggctgagaatgaatatgga
gtcggcctgcctgctgaactcaagaatgcagtgaaggcatctgaagtacctctggcagta
ggaaaggttactttgactgatgtgactaaagctagtgtctctatatcttgggaaaaacca
gagcatgacggtggtagcaggattactggttatttaatcgaaatgcaacctaaaggatca
gagaaatggaatgtagcaacatcaactaagacatgtgaaggcactgtttcaggactatct
tctggtcatgcatataacttccgtatcatagcctgtaatgagaaaggaaaaagtgagcca
actccacttgctgcgcctgttattgcaaatgatttgaatattgaacctagttttaaacta
ctatttaacagctacaatgtcaaagcaggtgaagaccttacaatagaaataccaatgatg
ggacgccctaagcctcaaattgattggatgaaggatggagaaacactaaaacagaccaca
agagtgacatatgtgactggaccagcctcaaccactcttatgatcaaggaagccaacaaa
gatgactttggcaaatacacagtgacagcatcgaacaacgcaggcaaagtaacagaggaa
attagaatcatagtccttgacaaacctggctcaccaacaggccccattaaatttaatgaa
gtaactaatacctctgtaaccatctcatgggagccacctgagtacacgggaggttgtcaa
ataaaaaattatattgttgagaaacgagacacaacaaccacgacatggcaagttgtgtct
gcgctcatcgcaagaactgctttgaagatttctaagctgaaaacagggtcagaatttcag
ttcagggtaagtgccgaaaacagatatggaaaaggcccctcactggactcgtcagctgtt
gttgtgcagtatccctacaagctgccagggcctcctggcacaccatttgtcagatcattg
gcaagagatcacatgattgttgaatggaatgagccagtcaacgatggtggcagtgccatt
attggttaccaccttgaaagcaaagaaagaaacagtgttctctgggtgaaattgaacaaa
attcttatcactgatactgtattcaaggtgaacaaccttgaagaaggaaatggatatgaa
tacagagtgtttggagaaaacattattggtgttggtcgatccagcaaggtctccgagtgt
tacattgctcgtgacccgtgtgatccacctggtacaccggaaccgatttctatctccaaa
aaccatattaaacttcagtggacaaaaccagaatatgatggtggaagcaagatcactgga
tatgtggtagagaagcgggacttgcctgaaggtcggtggacaaaagctagtttcacaaat
gttattgaaactgaatttacggtctcagggttaacccaggaccaaaagtatgagtttaga
ataatagcaaggaatgccgctggcattttcagtgagccctctgatagtactggaccaatt
actgccacagatgaaattgaaccaccgcgagcttctatggatcccaaatacaaagatgtt
gttgttgttaatgctggagaaaccctcgctcttgaagctgacatttatggaaaaccacca
cctgaggtcaaatgggtgagaaatggaaaagaaattgataaaagtactgcaaaaatggaa
gtaaaaaccactgtaaagcgctcagtgcttattgtaaaggactgcagtaaagatgacact
ggtaattatgacattactctcagtaatgttggtggaacaaaaacaatacccattaaagtg
aaagttctcgatcggcctggacctccagtcgctccactcaatatatctggagtgactgca
aactcatgtaacctgtcctggaatgagccatcacaggatggaggtgctaaggtttctcac
tacattattgagaaaagagaaacaagtcggctgtcgtggactttagctgaacctaaagtt
gaagccctcagtcacaaagtaaccaagctcctcactggtgaagagtatatcttcagagtt
atggcagttaacaagtatggagtgggtgagcctcttgaatctgagccagtaatggctcgc
aatccattcaagccaccaagtgcaccgtctactccagaggcaatttctgttaacaaagat
tcaatggttattatgtggaatccacctgaatacactggtggactagaaatccagtgctac
catcttgagaaacgtgacaaagatagtgccagatggacaaaatgcaacagagagaaactg
aaagagctgcaattcaaagtcactggacttgcagaagggcatttctatgagttccgagtc
tctgctgaaaatgaggttggtgttggggagacaagcaatccctcattgttctacagagcg
tgtgatgccacacgtccacctggtccaccctaccatcctaaagtgacagatcacacaaac
acatcagtttctctagcgtgggccaaaccagtagatgatggtggtgcatatataaaggga
taccttgtggaaatgaaagaaactgcccaggaagagtggacaatatgtacacccgcaact
ggtatacaagcaacacggtacactgtggaaaagctgaaggaaaattctgaatacaacttt
cgcatatgtgcgattaactctgaaggcattggagagccagctgacatccatggttctgta
attgctgttgacaaagctgaagctccagagatagaactagatgctgatttgaggaaagtt
gtatctgtgcgtgcaagtggaacacttcggctttttgtcccaataagaggacgacctgaa
cctaaagtaaaatgggagaaggaagacggttctttcactgagcgtgtacaggttgaagct
actggttcttacaccatgctcgtcatagataatgtcaacagatttgacagtggcaaatac
attttgactctggagaacaagagtgggacaaaatctgaatttatcaacgtgagaattttg
gactcaccaagtgcacctataaatttcgctgtcagagatgttaagaaagattcagtaaaa
ctcttatgggagcctcctttatttgatggtggagctaaaataacgaactatattgtggag
aaacgagaatctactagaaaggcatacaccgcagttacaaataattgcacacacacttca
tttgtcattatggaactacaagagggtggtatatattatttccgtgtacgggctgtcaat
gaatttggcattggcatcgcagttgaaactaaagatccagttaaagttgctcagccacct
atgccaccaggtaaagtttcagtcgtggatgttacacgaaatactgcaacactttcttgg
gaaaagccattacatgatggtggcagtaaaatcatatgctaccatgtggaaacacaaact
aagggcagcgataagtggaatgttggagccacagttcaggtattagaagcaacaattact
ggccttatgtcaggtgaagaataccatttcagagtcattgctgtgaatgaaaaaggaaag
agtgaaccacaagaactaggtgttcctgtgattgcaaaggatgttcagattgagcccacc
attaacttgcttttcaacacatacagtgtgaaagctggaaaagatcttaccattgaagtt
ccatttagaggcaggcctaagcctgttgtttcatggaagaaagatggtcttcctctcatg
cagacatcttcaataacaattttaacatcagagacgtcatcaaagatttctttcaaagaa
actaccagagatcatgttgggaaatatgaaatcgctgttgctaacactgctggcaccaaa
tctgcagaaattggtgttgtagtcctggacaagcctggcccaccatctgcaatgaaagta
gatgaagtgacttcagaaagcataactttatcctggaaaccaccagagtatgacggtgga
tgtcacattagcagttatattgtagagaagagggataccaacaccacagtctgggaaact
gtatcatccacacttgctagaacatctattaaaatctctcgcctgacacatggttctgaa
taccagttccgtatttatgctgtgaaccgttatggaaagggtccatctattgattcctca
agcattactgctgagtatccatacaagcatcctggtccaccatctacacctcgggttgcc
cttgcgacaaaggcattcatgctagtgacatggaatgaaccagtcaatgacggtggtagt
acagttctcggatatcacctggagcgcaaagaacgaagcagtgttctctggacaaagata
aatagacggttggtcaaggacacagagttcagggtgactggcattgaagagggtctattc
tatgagttccgtgtctatgctgaaaatattgtgggcattggaaaatgcagtaaaaccagt
gaaccagtcgctgcaagagatccttgtgatcctcctggtcaacccacagtcacaaatatt
accaaatcatccatctccttgtcttggaccaagccagaatatgatggtggagcaaaaatt
acaggttactttgttgaacgcagagaacttccacagggtcgttggatcagatgtaatttt
accaatatccaggaaacatacttagatgttacaggccttatagaaaaccagcaatacgat
ttccgtgccatagcaaagaatgcagcaggcctattcagcgcgccatctgattgtactggt
cctataactgttaaagatgatgtagaattaccacgaataatgctggatgtcaagttcaga
gacgttgttgtagtgaaggctggagatacactaaaaatcagtgctgatatttctggtcgg
cctttaccggtagtgtcctgggcaaaggatggtaaagaaatggaaccccgacaaagaatt
gagatttcttcaacagatacaagcacctctgtaactgttaaagactgtgtaagacgagac
tcaggacagtatctcttgactttacaaaatgtggctggaacaacatcgttccccattaac
tgtaagattcttgataagccaggaccatcagctggacctttagaggtatctgctattaca
tcagcaggttgcacgttgagttggggaccccctcaagaaactggtggtgctgaaatcact
cactatattgttgaaaagcgtgaaacaagccgcattgcctggacagtggtacatgcagag
gtgaaagcaacaacctgcaaagttactaaacttctcaaaggtaacgagtatatttttaga
gtcttaggtgtgaacaaatttggaacaggtgaagcactggagagtgaccccatcaaagtg
ctggatccattcactatcccttctacacctctacgtgtagagattgccaatgtgagcagt
gaggcaatgacaatctgctgggaaaaaccagactctgatggaggcagtaaaataagtagt
tacatcattgaaagacgggagaagtcaagcatgcgctgggtgcgcataaacaaaaagcct
gtcactgacaatactttcagagcaaccaacctccgtgcagaatgtgaatatgagtaccgt
gtttttgctgaaaatgctgctggactgagtcctccaagtgacccaagccctcttaccaaa
gcacaagatccacgattcccaccatccccgcccactaaaccaaaggttgttgattcaacg
aaagattccatgagtcttgtttggaataagccattgtctgatggtggaagtgccgttata
ggctacagtgtggagtacaagaaaactgaggacacagtctgggctgtggctgttcccatt
acaaggaataccgagttcacagttgttggattgtgtcctggagcggaatatgtgtttaga
gtcaagtcaatcagcaaaattggcgttagcgacccaagtccaacctcagagcctcatgtt
gcaaaggagagggaagaggagccagtgtttgatgttgacatcgaaatgcgaaagacaatg
attgtgaagcacggaaactcatttaccctgacagtgccattcaagggaaagccggtgccc
agcgttgtgtgggagaaagacgacataaatctaaaagagagagcaagtatcgacacaagt
gatgcctgtacatcacttacagcagaaaaggcaacaagatacgactctggcaaatacatt
gtgacattaaagaatccacttggaactgctgctttggcactgtctgtcaatgtactcgat
tctcctgggcctccttcacaagttaaaatcacagatgttaccaaagaatcagtgacagta
acatggaatgcaccagaaaacgatggtggtgaccctgtcaagaactaccatgtagaaaag
cgtgaagcaagcaagaaggcctggatcaatgtgacaaataactgtcgtaatctgagctac
aaagtaaaagacttgcaagagggagctgtttactacttcagagtcattggtgaaaatgag
tttggaatcggcgtgccttctgagatcaaagatgggactatgattacagaaaaaccaagt
gcaccaacaaggattgcagttactgcagtaacaaaagacagtgtttcactggcttggagt
agaccagagcatgatggaggcagcaagattaccggttaccttattgatgctcttgaaaaa
ggacagaagaagtgggtcaagtgtgctgtggttaaagccaaccaacatgtcatccgtggc
ctaagggaaaatgccgaatatttcttcagagtccgtgctgaaaaccacgctggcctaagt
gaaccaaaagaaatgattgttcctatgattgtgaaggatcagattgaatccccagagttt
gacatgaagaacttccctcggaatactgtgtatgtcagagctggatcaaacctcacgttt
gaaatccccctcacaggaagacctctgccaaaggttacagttaccaaggacaatgttact
gtaaaagttactaagaggtttaaatttgaggttactcctgaaggattattagtaaacctt
gatgaaagcgttgctagtgattctggcaaatatgacatcactgcctccaaccaaggtgga
gttgccaagtcatttgtgaacattttagtgcttgatcgaccaggtccacctgttggtccc
gttaaaattggtgagaccactgaaaccagtgtgagtctcaaatggcttcctcctgtgtat
aatggtggcagcccagttactaattacatcatactcaaacgtgagacaagcactcctacc
tggactgaggtttcctctacagttgcaagaaacgaaattaaagtgactaagctgaccaaa
ggggaagagtaccagttcagaatcaaagctgagaaccgctttggaatcagtgatcacatt
gactcaacttccgtcactgtgaaactcccctacacaacccctggacctccatcgacgcca
tgggtcagttttgtatcaagggagagccttacagtctgctggcacgagcctgtctttgat
ggtgggaaccacgtgtttggttaccacttacagatgaaagaaagaagtagcgccttgtgg
cagaaaataaacaaaactcctataagtggcacacagtatcgcgtgaaaaacatttgccct
ggctatatctatgaattcagggtggcagcagagaatgctgctggtataggtaaaatcagt
aagacatcagaagaggtccttgcaattgatgcctgtgagcctccagctaatctgcgtatc
actgatgtcacgaaaaacacagtcagtcttgtgtggcagaaacctccatttgatggtgga
agcaagatcactggatatgttgttgagaagagagagtcgccaaaaggcagatggacaaag
gctaacttcaccaatgtcatcgagacaaatttcattgtgtcaggcttaactcaggatgaa
tcctatgaattcagggtttttgcaaggaatgcggttggctctctcagcaacccatcgctc
attgcaggaccagtgaaatgtatcgatgttcagggagctcctgaaattgaccttccaccg
gagtatcttgatgttgtgaagttcaaagctggcaaggtgattaagattcgtgtgggaatt
atcgccaagccacttccaacaatcgaatggagcaaagacggcaaggaattagtgtctagt
gctcaggtatcggttgagagcacaacagattcttctggaattctcatcaaggatgccagt
cgtctaaacactggaacctatgaaatcaaaattaagaatgccttgggatcagcatctgca
tccatcagagttcagattctagataaacctggaatacctgctggaaatattgacttcaag
tctgtcacagaagacaagatcaccattgcttgggaacctcctgctgatgacggcggagct
ccaatcactcattacattgtagaaaagcgtgaaacaagtagggttgcctggtctattgtg
tctgaagagacagaacaacgcgctgtgtctgctgagaagctggtcaggggcagtgagtac
gttttccgagtcagggctgtgaacaagtttggagttggagaacctctggagtcggaacct
gttattgccaagaatgcatttgttacccctgggcaacctacaacacctgaggtgactgcc
attactaggtccacaatgatagtagtctgggacaaacctagggtggatggaggaagtccc
atccttggatacgctctggagaaacggaacaaaaagaacctgcgctgggagaaggtcttc
agagaacctgttcaagagacaacacagaaagttcacaacctaacagagggtaatgagtat
cagtaccgtgtgtacgcaattaataaagctggagaaggtcccttctcagatgattctgac
ttctacagagctgctgacccaattgatccacctgatgaaccatccaagcttaaagtggtt
gactccaccaaaacatccatcactcttggttggactaagccggaatataatggaggcagt
gaggtcaccagctatgttgttgagaagagggtggcccaagaaactgactgggttgttgtt
agtgccaagggtgaagtgagaaccacggaatatgttgtgtctcaacttaagcctgatgtt
gagtacttgttccgtgtatcagctgttaactgtgccggacgtggaaagccaatagagatg
acagagccagttcaggctaaggacatccttgaggaagctcagatagaccttgatgttcct
atgaggacacaatacacagtaaaggcaggagcagacgtggagataacggttccaattaag
gggagacctgcaccaagtgcaacttggaaaaagggagaagaaaacataagcactaatctc
agatatgacatccacaccacagaatcctcaactatccttgtcattccacaggttactcgt
aatgacactggccaatataacgttcagattgagaacgctgtaggagagccaaagacagta
actgtgtctgttaaagtccttgacactccatctgcttgccaaaaactattgctgaaggat
gttactcgtggtaaagtaacactgacttggcaacctcccctccttgatggtggagcacca
attactagttatatagtcgaaaagagggactccagcaagaggtcattctcaagtgtagcc
aagtgtaccaccaccatgtatcagatcgaggaactctctgagaagtgctcctatttcttc
cgcgttagagccgagaatgaaaacggagttggtgatccatgtgacacagcagaacctgtt
aaggccacagagacaccaggcccagtaaaaaacctttccatgaaagactctaccaaaact
tcagtcacactacagtggagtaagcccgactatgatggtggcagcatcataacggattac
atcgttgagaagagactccaggaggaagacgtatggtcatttgcaggcaccagcaaacag
tgtgaatacgaagttacaaaactgaaagaactctcgcagatgcacttcagagtgtgctcc
aagaatgaaaagggacaaagtgacttcaccgaaactggacctatcaaagtaaaggacttt
atcattcctcctgaggccgacttatcagaatatccagacggggaaatcaacgtacgactt
ggacacaatgtgcacatcgagcttccatacaagggtaaaccgagaccttccactgagtgg
ctgaaagacaacctccctctgaaggagagtgatcaggtgcgctttaagaagacagaaaac
aaagttactctcatgataaagaatcttaaaaaggaaactggaggaaaatatactataacc
cttgataacaaagcctgtaggaggtcattccacatacaagttaatgctctcggacctcca
tccaggcctattggccctatccgatttgacgaaatcagagctgagagcataataatatct
tgggatcagccagccgataacggtggaggagaagtcaccagctatactgtggagaaacgc
gacacttcacaggatgactggaagatggtttgctcggctgtggctgggacaacattcaaa
gtgactaatctgattaagggaacaggatatcagtttagggtgtgtgcagaaaacagatat
ggcattagcgagccactggtttcacacaatgtgcttgccaaacacgaattcagaccaccg
ggacctccaggaaagccttttgtgtacaatgtcacaaatgatggcatgaccatccagtgg
gatgctcctgtttatgatggtggctcaccagtgaccggctttcatgttgagaagaaagag
cgaaacagtgttttgtggctgaaagtgaaccctctggtaataacggagaggacctataga
atcattggtttgatcgaagggctggagtaccagttccgagtgtacgcacagaatgactcc
ggctacagccgtgtcggtgaagcaagcaagtacaccacagcagtgtctccagtcgatcta
ccaggcactccggactatactgacataacgagtgaatccgtctcactaaaatgggaacca
cccaagcatgacgggggcagtaaaattgtggcctacaatgtagagaaacgccagggacag
ggtcgctggctcaagtgcaacttctccgatgtccatgaatgtcagttcactgtgacgggt
ctcagctgcggagagcgatatgaattcagaataattgcaagaaatgctattggcacagtt
agtccaccttcccagtcctcaggatacattttagtcagagatgaaagtgttgctccaaat
attgaatttagccaggacgtctctgatggtctcacagtcaaagcaggagataaaatcaga
gttaaagtcacaatcactggaaggcctgagcctaaagtcacctggtttaaagacgacaag
gaaattgacaagaagtcaatggttgaaatcataacagctcctcgatcgagtactcttttc
gtgagagatgctgaccgcagtcaccgtggcttatacagagtggaagctacaaataactct
ggaaccaagaaggagaatatcgatataagagttcttgacaatccaggtgagcctataggg
cctatcacattttcaaatatctccgagggcaaagcaacgctttcatggaatctacctgaa
aatgatggatgctcccccatcacacattatgttattgagaaacgagaaactaccaagatt
tcctggacccttgtgacagacgagtgcaaggcctgcacatataatgcaacaaagctgctg
aagaccaatgagtaccagtttcgtgtttctgctgtcaataggtttggtaacagcaggcca
ctagagtctgacccaattattgcacagatgcaatacactgtccctgatcctcctggcacc
cctgattcaaccagtgtcacacgagacagcattacactctcttgggaaccaccaaaatct
gatggaggaaatgaaatcaaatattacatcgtggaaagacgagagaagaagagcttgcgc
tgggtgaagattctgacaaggaagcccataactgaggcagcccatagggtgacaaacctg
actgaagggagtgaacatgaattccgcgtgatggctgtaaatgacgctggaactagtgag
ccaagcaacacatcaatgctgataaaatgttgtgaaccaactactgtgccaagtgcacct
tctatagtgaccataacagattctacaaacacatccatcagtctagaatggaccaagcct
gctcatgatggtggcctcgagattcttggatacatcattgagaagtgcaaagctagctca
aaagaatgggaaaaagtcaacactgagtattgcaccagcaccaggttcacagcaacaggt
ctggaatccggcgaagagtataaattccgtgtctgtgcagtaaataaagcgggaaaggga
gacgctcgtgagattcttgaagctgtacaagctgttgacagacttagtcctccagaaatt
gaaatcgatgcaagcttcaaacagacacacatcataaagaacggaggcactgcacatcta
tctatagcattcaaaggaaatccaactcctgtagccacttggaaaaaggttgatggagac
cttggtataatggcagatgttaataccacagagaataatagtacgttgaccattgaaaac
tgcaacagaaatgattctgggaagtatacacttactcttgagaacagcggtggaagcaaa
tctataatgttcacaataaaggtactagattcaccagggcaacctggaccaatatcctac
aaggatgtctcaagaggagctctcacgctgacctgggatgccccgaccaatgacggagga
gcccgcattcatcactacattgttgagaaacgtgaggcaagccgtcgctgttggcaggaa
gtcagcaagtcttctgaccaaatgctgagagtgagtgacctattagaaggtgtgccatac
ttcttcagagtctctgcagaaaatcagtttggccagggtgaagcgtttgaaacagttgat
ccagttattgctactgcagaacccgctcctccaaagaggctggacatagttgacacaaca
gattcaacagccaccgtggcctggttgaaacccgaacacgatggtggaagtcgtatcacg
ggctacgttgttgaaactaaagaaaagggaactgataaatgggttgttggtggtcacact
aagtctttgagcacggtaattgaaggactggcagaaaacacagaatacgaattccgagtc
aaggctaaaaatgacgctggttttagtgagccaagagaggctcttgcctctgtcatcatc
aaggaacctcgtattgagccgactgcagacctcagtggtattactgagcagcttatcacg
tgcaagtcaggaagtaccttcaccatcgatgttcccattagcggcagaccagcgcctaac
gttacttggaaacttgaggaaatgagactgaaacaaactgatcgagtctccattaaaact
accagagacaggacaaccttgactgttaaagagagcatgcgtggtgatggtggaaaatat
tacctgaccctggaaaatgtcactggaagcaaaaccttcacagtcactgtcaatgtcact
ggcagacctaatgctccctctggacccattgaggtctcatcaatcacatcagagtcctgc
gtgctgaagtgggagccacctgaagatgatggcggtactgatattaccaactacattgtg
gagaagcgtgagtccggctctactgcctggcagctggtgaattccagcataaagcgtaca
acgttccaggttacaaatctaactaagtacatgcagtacactttccgagtctctgctgaa
aacagatttggtgtgagcaagcccactgagtccgagactgttgttgctgaacatccatat
gttccaccaagccccccgactcgaccagaagtattctcagtcagtggaaatgctatgagt
attcgctgggaggagccatatcatgatggcggcagcaaagtgaatggatactggattgag
aagaaggagcgcaacaccatcctttgggtcagggtgaacaaagtcccgtgctttgaatgc
tactacaaagtaactgaacttgtggagggccttgagtaccagttcagggtttatgcaatg
aatgctgcaggactgagtaaagccagtgaagcctcaaagagaatggtggctcagaatcca
gttgatccccctggcaaaccagaagtcactaaagtgacgagatctacagtatccatcaag
tggtccacgccactcaatgatggtggcagtccaattgctggatatattgttgagcgcaaa
ccgtatactatttcgggtgagggtcgctggctcaagtgcaactacacaaacatcactgag
acaaacttcaccgtaacagccttgggtgagggggagtcatatgagttccgggttattgca
aggaacacagccggggtgcacagtctgccctcggaatccacaggatctgtgacatgcaaa
gccgaatacagtcctcctactgctgagcttgacagcaaacttctctcagagactgtgact
gtcagagccggaggggaccttgttcttgatgctgctatcggtggtaaacctgaccccaag
gccttttgggctaagggacagaaagaactggaactctgtgagaagtatttcctgcagtac
accagcactcgtgctatggctataatcaagttctgcgacagagatgattctggaatttac
aacctgacagtaaagaatgccagtggtgtcaagacagcagctgtcaacgttaaagtactt
gacacacctggaccttgtgaggacaagatcaccattagcaatgtgtcggaacaaaagtgc
actgtgtcctggaaaaagcctctgcaggatggtggagatgagatcacgcactacgttgtt
gagagacgtgacaccaatagactcaactgggtcataatggagtcggagtgcaagagtctc
tcatgtgtcattggcagaatgattaaaaatcacgaatacttgttccgtctcagagcagtg
aacaagtacgggcctggtgtgcccctccagtccgaccccgtcgtggccagaaacacgttc
actgtgccatcaccgcctggggcaccagaaatcattgttgttggaaaggattttgcaacc
atccagtggctgaagccagagaacgacggtggcagtgaagttaccaactacctcgtggag
aagcacgaaaggaagagcatcaggtggaccaaagtcaacagagacttgcctataactgac
accacgtttaaggtgactggtcttcagacaggcaatgtttaccagttccgcgtcaccgcc
atgaatgcggctggagacagtgagccaagtgaagtatccctgtacgcagtttgcagggag
gccactttcgttccagctcctccctcgatcccacgcgtgtctgacacgacgaaggacggc
gtcagccttgtctggacaaggccgacagatgatggcggtgcagacattattggatatgtt
ctcgagatgcaagaagtgggggcagaacaatggactaaagctcatgaaaagaatctgaag
gacactgagtacactgtgactggcctttctgccaacaaaaagtatctgttcagagtagct
gccattaacgtcaacggcaccggcgatttcagtgacccctgtacagaagtcgagcctcag
gaaagactagaatcccctgatattgatgttcctgatgaactcaagaaaaccatctgcctg
agagccggtggttcccttcacctagttgttacagtgacaggaagaccaacccctgtagtg
acctggagcaaacctggggtagttctgcaaaatcgtggttttattgaggtcgccaagaat
catgcctctctgatcattgacaatgtgcaccgatatgatgctggcacatacaccattgaa
gctgagaattcatctggcaagaagtcagcaaccatacttgtcaagatttatgatactcca
gggccacctggtgcacttaaaattaaggatctcacgaaggattctgcggtgattacatgg
gatcctccaagcgttgatggtggagcacccgtgaataactacatcattgagaggcgtgac
acatcgatgagggcctacaagacagtgacatctaaatgtcacaagacatcctacaaaatt
actggcctcatggaaggactgctatactgcttccgggtcttgccagagaacatatatggt
atcggtgaggcttgtgagatcagtgatgctgtactggtatgtgaggtacccatggttcca
cagaagctggacgtggtcgatgtcaccaagagcacagtgacactagcgtgggagaagccg
ctgcatgacggtggtagcagaatcactggttacataattgaagcgtgtcgcagcggaaca
gacaagtggatgaaggtggctactctgaaaatgacagatttcgagcacactgttgtttcc
ctgaacgaaaaagagcagtacctcttcagggtcagagctctgaacagcagaggagcaagt
gagcccagagagattgtcacagctgtaaccgtccaagagcaaagagtaatgcccaagatc
gacttgtctgcatttcctcacaagtctatcagtgtaccagcaggcaaaccaattgagctg
ggcttgccagtcatcggtagacctcctccgctttgctcatggtactttggtgatgtaaag
ttgaaaacccacaaccgtgtcaaaattgaaagctcagcaaaatactccaaactgactgtg
agtgacacgacgatcgatgacacaggcgactacatgcttgagttgaggaatgcagtaggt
actgctacagaggtcattaaagtcatcattctagcccaacctgatgagccccgaggacca
atcagatttgatgagatcgacgctacatctgtcactatcagctgggatccacctgagagg
gatggaggttctcccatcactcactacgttgttgaaatgcgtgatgctcaccgtccaggg
tggctccctgtgtctgagtctgtcagcagacccacgtacaaatttgccaggttgacagag
ggagatgaatatgtgttccgtgttgctgcagcgaaccgctttggcgccggatcattcttg
cagtctgacaacgtaatttgcaagagtgccaaaaccccaccaggaccaccaggtagaccc
gaagtgtttgacatgtcacgagatggaatgactttggcttggttcccaccagatgaagat
ggtggatctaaggtgacgggatatatcattgaacgcaaagaagtcagatccgatcgatgg
gtgcgagttaataaaaatccagtgacaatgaccagatacagatctactggcctcattgaa
ggcctggaatacgagcacagagttacagctattaactccagaggcattggcaaacccagt
cttctttctaagccagcagtggcaacagatcctgttgatccgcctggctcacctcaaaac
cccagagttgtagatacaactaaaacatctgtatctctggcttggagtcctcctgatgag
gagggtggctccaaagtcaccggctacttgatagaaatgcagaaggttggctcgtttaac
tggattaaatgcaacgcaactccagcactgatctgtgagtacaccctaacacaaatgccc
ccaggggaggagttcaagttccgcgtattggcatgtaatgctggtggcacaggagagcca
gccgaagtcccaggaaccattaaagttacagaaatgcttgaacctcctacttatgacctg
gaagctaagtaccaagaaggcattgttgtcagacagggtgcagtcatcagactatgtgtg
ccaatcaagggtaaaccaagccctacctgcaaatggacaaaggaaggttgtgatcttact
cagagggctatgattgccaacacagaagacctcgcagagcttgtgatcaaagaagcgaac
aaagacgacagcggcacctacaatcttgtgctggagaacaaatgtggcagaaaaactgcg
gtgattaaagtgaaagtcattgggcctccagggccacctgagggtccacttagattcgat
gacatccatgcgcactctgtgaaagtgagctggaaagcccctgtagatgatggtggctct
ccagttcttggctacattgttgagagacgtaaggtccccaaagcagcgtggtacacagtg
gacaccagggtggtagacacatctttggtggtaaaaggtttgaaagaaaatattgagtat
gagttcaaagtgacagctgagaaccagtttggcaccagtaaatctctgaagtcgcatgaa
actgtcacgcccaaaacacctctatgtcctccagaacctcctagcaacccaccagaaatc
gtcgatgtcacaaagagctctgttgccctgtcatggtccagacctaaatacgatggaggg
tctcgcgtttccagctactttgttgaacacagagaggcttccaccgatgagtggatacgt
cacgagaagcagattacaactaccatgtacacactatctgggctaacccctgagaaagag
tatcatttccgtgtcattgccaaaaatgacattggggagagtgagccgggacctgcttca
gactcagttatatgcaaagatccatttgacaaaccaagccaaccaggtgagatcgataca
gtaatagtgacgaaagactacatctccatccgctgggagcgcccagagtgtgatggtgga
aaggagattctgggatactgggttgaatacaggatgtgtggagaaagttcttggaagaaa
tgtaacacagagcgcacaaaggacaaagaatttacaatgggcaacctcagagaggctact
gaatatgagttcagagtgtttgctgaaaatgaaactgggataagccgaccccgcagaacg
gccacaagtatcaaaactaaactgagtgttggtgataaaccaagcctgcgcaaagagata
gaagaagtcacagccaaacttgggcagtcagcaatactgaagtgccaaatcattggcaga
cctcttccagagatcagatggtacaggcacggcaaagagctgatgcagactgagaagtat
gcaatgacctcagacggtcgaatccatacgctaaaggtcctggcaaacaggcaggaggac
gaaggcatatacacatgtaaagctgtcaacgaggctggagaggtagaaacaagtgggagt
cttgttctggaggctcctcctcagatacatccagaataccctctgaaggagatatattac
gcagggtgtggtacaagcctacgtctgcacgttgtgtacattggacgcccagaaccaaag
ataatgtggttccacaacaacaaacctctggaaccatctgacagagtcataattgaaaac
acggatcattacacccatctagtcatcaaggatgtgcaccgcaaggatgctggaaaatat
aaagtatggtttagaaatgtttttggaacagtagacactgtactcagcgttgacattcaa
gataaaccccgtgtgccagtggggccaatagttgttgatgctcttctgaagaactctgtg
atcattagctggaacccacctgctgatgatggtggagcaatgattacaaactacattgtg
gagaagcgtgaggaaactgaaggtgcgccgtggcagttagtatcatcttcagtctcagga
acatcgtgcagagttccaaatcttaccgaaggagctggatattacttcagagtgtctgct
caaaatcggtatggcaacagcgaccccctggagatccctgctgtggtcattattaagagt
cagctagataaacctggaattccacaaaaacttgctgtttccggaataactaaaaattca
tgtatagtgtcttggaggccacctattagtgatggcggttcaaagatcaagaactactac
cttgagaaacgagatttgaaatcaggtcaatgggtggcagtgaccactgatgaaattcac
cagacagtctactgtgtcaaaggcctggttgaaggtttgcagtatgaattcagaatcaaa
tgtgaaaatcttggcggagaaagtgaatggagtgaagcatctgcaccaatcactgcaaca
ggcgagattgagatccgtgctcctgcttttaaagaagaactgaggaacatgagtgtgaag
tacaagagcaaggccactctagtctgtaaagtcagtgggcaacctaagcctgttgttaaa
tggtacaagcgtggcaaagagattcactctgaaggagaaaaaattaaaattcaagaattc
aaaggtggctatcatcaactggtcatcactgctgctgatgaggaggactcaacagtctat
cagatcagggttacaaaccagggaggatcaatcgcagcaactgtctctctggatgtggaa
gtgcctgccaagatccacctgcctaaaaatttgcaagaaaaagaagcagtgctagcactt
cgtggtgaagtggttagcatcaagattcctttcagcggaaaacccgatccagtgatcacg
tggcagaaaggacaagacctcattgacagcaatggccattaccaagtaattgttaccagg
tctttcacatccttggtattctctaatggaattgaaaggaaagatgctggcttctacata
gtttgtgcaaagaacagatttggcattgaccagcagactgtcgagattgatgttgcggat
gtccctgatccaccgagaggcatcaaagccagtgatgtgtccagggattctgtgaccctc
aactggtgtgcgccggctaatgatggaggaagcaaggtcaccagttacattgtggaaaaa
tgtgctaccactgcagagaaatggacacgtgtagctcagtcccgtgacacgcgctacacg
gttatcaacttgttcggcaagacaagttatcaattccgcgtcattgccgaaaacaaattt
ggccaaagtgagccatcagaaccaacaggtcctgtagttacgaaagaggataaatcccga
gtgctgaattatgatgaggaagtggatgatgttagagaagtcacagcagccaaagctcct
cattcagacaccaagaatctgcacaacaaatacatgattgctgaggagctgggacgtgga
cagtttgctattgtccaccgttgtactgaagtgagctctgagaagacatatatggtcaaa
tttgttaaagtgaaaggtgctgatcaggcagttgtgaaaaaagaaattgccacacttaac
gtggcacgacacagaaacttcctgtgtctccatgagtcatttgagagtcctgaggaatta
gtcatgatctatgacttcatttccggtgtagacatttttgaacgcattgcaacaccagac
tttgagcttactgaacgagtgatagtaaactacatcaagcagatctgtgaagctcttgca
ttccttcatagtaagagctatgggcattttgacatcaagcctgaaaacattgtctatacc
acaagaaagagcaccaaaatcaagataattgaaatgggtcaagcaagacaccttacacct
ggagataccataaaaatccagttcactgcacctgagtattgtgcccctgaaatccaccag
catgacttggtgagcactgtcaccgacatgtggtcagttggtgtgcttgcatacgtgctt
cttagtggacttaatccgttcatagctgaaactaatcagcaggtgattgacaacatctca
aatgcagaatacagttttgatgatgaagccttcaagaaagctagtcttgatgcattagac
tttgtggacagacttctgacaaaagaccgcaaacatcgtatgactgctgctgaagcactg
gaacatccttggctgaaaactaaccctgaagaactcagcaacacagccataaagacctca
aggcacaaaagatattatcagaccttggtgaagaaagaatggaatgttgttgtttcagca
gctcgtgttgcaagtggaggtaccatcagaagtcaaagaggggtcacagttggcaaagtc
aagattgcaccatttgaacatggtcctgttgctggtcaggtcaaacacaatgctacagag
gaaggaggagatgcaaaatttatatgtcatattgagaactacgacagcagcacagaagtg
acttggtactgtggagtgagacaacttgaagaaagtgataagtacgaaatcagctatgaa
gatggagtagccatcttgtctgtgaagggggtggtcagagctgatgatgggacatacagg
tgcaaagtcgttaatgaatatggagaggacagtgcctatgcagaactctttgttgaagga
gtcagatcttaccgtgatttctttgttggacgcacagtgaaaaaagcaaaacgtaaagta
gatacatctagaatccttcaaaggccacctgaatttaccctacctctgatcaaccgcact
gcacatattggtgaagatgtgcgttttggagtcaccataactgtgcatccggagcctcgt
gttatgtggctgaagtctggacaaaaaatcacaccaggagaggatgacagaaaatacaca
tttacaagtgacaagggtctctatcagctagtggttcacaatgttgactttaatgatgat
gctgaatacaccgttgtggcacgcaaccgatttggggacgacagctgtaaggcacgtcta
acggtaactccgcgacccactcctgctgacacaaccctgaggcccatgttcaaacgagtc
cttgcaaatttagagtgcagagagggccagagtgttcgctttgaagtgagagtgtcagga
tcgcctatcctgaagtgggagaaagatggcacacctttgtcttttgggccgcaaattgaa
gtcgttcacgaaggcttggattattatgtcctgcatgtcaaagacactcttcccgaagat
tccggcacatacagagtgacagccacaaactcagctggatctgcaagctgccaagcaaca
ctgagagtagaacgtgttacccatgtaaagaaagaatacgagagtgaggcagatcaaaag
aaacgagctgagaaggaagaaattgacaagaaggtgagattatcacaaatcctttcaggc
acagaagtcactccgctcatcccagtggcacaacaggctttaagagaggctgcagttatg
tataaacctgcactgagtaaaacagacaaagctgaaattgcagatagaaaggaaaaagag
gaaaggaaaaagagagcagatgaaaagagacttcggatgccatataatatcccacagccg
cgtgtccacgctccaacggcccttgagcaggacaatgagattaagtattttgtgcctttt
tcggatatgaagtggtataagaaactccgtgaccagtttgaaatgccggaaccactggaa
aaacatccacagaagagactgaaacgcattcgactctcaagatgggacaaattctatgaa
gtgcctgtcgcaaggattaaagatcactatgtgtctaggaggatcgttctaaaggcttcc
caagatgatttagaaactgtaagaccagcacggtaccgcacaccatctcccgaatctgag
gcattctaccgaccaagaaggaggtcacttggtgacctctcagacgaggagcttctcctc
ccagttcaggactacttgtccatgaagaggactgaagaagagagacttcgacttgaagag
gaactggagcttggcttttctgcctctccaccaagtctgagccctgtgcgctttgaacta
tctccattgcgacatccacctgcaaagagaaggacatatgaggaggaagacgaagaagaa
gagattcaaagatatgactcatatcgtattccatctaaacacgaagctggtccaagcttc
attgatctccggcaacgccatgagaaagcaacgtatagagctccaaagcaaaagcaaaga
gtacatgaagaaagggaggatcatgagattcttcgtcctgtagctacggcccaaaggctt
actacctacaaaaatgagctgaaacgtattgagtttgaagagaaaacttctgtgtcaaga
aaagaacgaaaagtacatatttcgtcagcagccacagaaggactggagccaagcactaca
tatatgcctatacataccccccttacacgtcctgtgtctgtaccactcagatcacccacc
cctgacaaagcacaagcacgttccccaagtcccatcataactgagaccacacccttcaag
cccgaagagtctgcaagagttgacttcatctctagatacgaagcaagaaaagcagctctc
aaaactgaaaggaagtacgaggttgtgactcagcagccattcagccttgaccatgctcct
cgcataaccgtgagaatgcgctctcatcgcgtaccttttggtcaaaatactaaattcacg
ctaaatgtacaagccaagccatatgctgcaattaagtggtttcataatggacaggagatt
caggagggaagcaagttccaatttagcaacatcagtggggttttgtccctccaaattttt
gattgccagttagaagacagtggtacgtaccgtgtttcttgcaaaaatccaaaaggagaa
gcctctgattatgccactctggatgtaacaggaggagagtattcttcagtatcttctcat
cgcaaagatgaggaacctcccacaccttttgttcctgaaatgacaaagacagaggtttat
catgtatcctcctcaaaggcagctgcatcttctgaaacacatgtagaagtaaaagaaacc
aaatcagaaatacatgaatcgcgtgaacatgttcagtatgaagaatgtgtaacatctgaa
aagatggaaatcctggaagtcacaaaactgaaggaagtaactgtacatgaggaaaaggtg
gaaactgtagaagtgaaaaaagtggaagaagtcattgtgcaagaggaagtgaaacccggt
atacctgcaaaaatagtaacgaaacctgagtctcttacagtttctgaaggggagtcagct
aagtttacctgtgattgtgatggcgatccgacacccagcgttacctggatgcatgaagga
caaataatcgtctcttcccatcggtaccaagtgacttcattagaacataagtctatcttt
gagatttcttctgttgaaacagcagatgagggaaattatattgtggttgtgcagaattct
gagggtaaacaggaggcacagttcagtctaacaatccgcaaagccacacctaaagagaaa
gccattgcatcaccacctaaagtaaagtcacctgagcccagactaaaatctccagtatcg
ccactcgccaagtcacccgagcctcgtatcagatcaccgtttggaataaaatcaccacca
aagattaaatcacctgagcccagagtgaaatcaccagtgtccccaggtgccaaatcccca
gagcctcacattatgtcacctgtagaaactagttcacaacctgcaacaaagtcacctgaa
ccaagagtaaaatctccaatatcgcctagtcccaagtctccagaacctcgtttaaagtca
ccatttgagattaaatcaccacatgcattgaggtctcctgaacccagagtgaaatctcca
ggttccccaggtcccaaaactccagaacctcgtattaagtcacccgtagaaataaagtca
ccatccagagtgaaatcaccagagcccagagtaacatctccattgttcccaagtcccaaa
tcgccggagcctcgtgtcaagtctcctgatcctgcagccccacctcagaggattaagtcc
ccattcgcagttaagtcaccaactccaaccaaggcttctgcaacgagaccagatttctct
gtgactctgaaagatgtcacagcatcttcggattctattgtaaagctgtcagtcaaagca
acgggagatcccacaccagtgttttcctggatgaaagatgaaaagatcatctctcaaggt
ggaagatatgatatttttgaagaggatggattttcatatcttgagatctatgaaactgag
gtttctgatactggggtgtacaaatgtattgccagcaattctgctgggtcctgtacgtca
acctgtcgtgtcaccattcaagcattcaaggaaagcaaagccattcagataattgatgag
aaagaggccatcctttcctcgcatgtgaaaagagaagtgagggaacaaaccgttctgact
gaggaatcttccaggaggatggttagagaggaagggttttctagcatgacagtccactct
gctgcctctatgcaggaggcttcgttcagcagctccagagtggctgaatctcagttcgaa
tccatgtctgctacaagtacatcctctgtgacttcgaaatccatgagcttcacaagtatg
atggaggaaatgacgggccaaaaagtcacttcacatagtcttcagggcacaacaaagaaa
attgaggctctctctgaagacgtgagcgtagattaa

DBGET integrated database retrieval system