KEGG   Scleropages formosus (Asian bonytongue): 108928614
Entry
108928614         CDS       T04919                                 

Definition
(RefSeq) delta(14)-sterol reductase-like isoform X1
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00100  Steroid biosynthesis
sfm01100  Metabolic pathways
Module
sfm_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    108928614
Enzymes [BR:sfm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     108928614
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 108928614
NCBI-ProteinID: XP_018598131
Position
10
AA seq 459 aa
MKHGTMPVSSVQRSTFDDSESLNGHSGQETTPRGLSQFLLMLILSRAFDRRPLVFVFTFS
DLLLLCIFLPALLLLVLDGCRAPAEPWFFSGAGMAQLWDWGALQLVVLFTVLQGALYYLP
FGKVAEGKVGHGGTCIKYSMNGLHALVVTVLLVAGLWHHGSFQGAAISSRVPQLVTASTA
VALVLSIAVYLRSFTVLPQQLVNYGTKGNFLQEFALGREMDPSVGKVDLKQFMMVRIGFI
GWTLVDISYLLAEIETKGWPTVPLLMVVTFHLVYILDFLIDEDTVLPTKEYTEDGIGFLM
ILGEYIWIPFYSSMPIYFLLHRPTQISPLSAVLICLMFAFGFVTYYMSNEQKSEFRKNPN
NPSLAHLETIASPSGKKLLVSGWFGWVRHPNYLGDIMMTLAWCLPCGFTSFLPYLPALQC
TNLLRLRAAEIEEACRKRHREAWQEYCRRVPYQLVPYVY
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgaaacatggaacaatgcctgtgagttcggttcaacgttcaacctttgacgactccgag
tcgctgaatggacattcgggtcaagagacgacgccgagaggtctctctcagtttctgcta
atgctgattctctctcgcgccttcgatcgacgtcctctcgtgtttgtttttacgttctca
gatcttctcctgctctgcatctttcttcctgcgttgttgcttctcgtcctggatggatgc
cgggctcctgcagaaccctggttcttttctggggctggaatggctcagttgtgggactgg
ggggccctgcagctggtagtgctttttactgtcctccagggggcgctatactaccttcct
tttggcaaggtggctgaaggcaaagtaggacatggtgggacgtgcataaagtactccatg
aacggcctgcatgccctagtagtcacagtgctactcgtagcggggctttggcaccacggc
tcatttcagggggcggcaatcagcagtcgggtcccacagctggtgaccgccagcactgcc
gtcgccctggtgctcagcatagccgtgtacctacggtccttcaccgtcctccctcaacag
cttgtcaactacgggaccaagggtaacttcctgcaggagtttgctctgggcagagagatg
gacccatcggtgggtaaggttgacctgaagcagttcatgatggtcagaattgggttcatt
ggatggactctggtggacatcagctacctgctcgcagagatcgagacaaaggggtggcct
actgtacccctgctcatggtggtgacatttcacttagtttacatattggatttcctcatt
gatgaggatacagttttgcctacaaaagaatacacagaggatgggatcggctttctcatg
attcttggcgagtatatatggattcctttctactccagcatgccgatttactttctgctt
caccggccaactcagatcagcccactgtcagctgtcctgatctgcctgatgtttgcattt
ggctttgttacctattacatgtccaatgaacagaagagtgagttccgtaaaaacccaaac
aatccctctttagctcacctggagactattgccagcccctctggaaagaagctgttggtg
tcaggctggtttggttgggtgcgtcaccccaactaccttggagacatcatgatgaccctg
gcctggtgcctgccttgtgggttcaccagcttcctcccatacctgcccgccctccaatgc
accaacctgctgcgtttaagggctgcggagattgaggaggcatgcaggaagaggcatcgc
gaggcctggcaggagtactgccgccgtgtgccgtaccaactggtgccatatgtgtactga

DBGET integrated database retrieval system