KEGG   Scleropages formosus (Asian bonytongue): 108929121Help
Entry
108929121         CDS       T04919                                 

Gene name
tgfb2
Definition
(RefSeq) transforming growth factor beta-2 proprotein
  KO
K13376  transforming growth factor beta-2
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm04010  MAPK signaling pathway
sfm04060  Cytokine-cytokine receptor interaction
sfm04068  FoxO signaling pathway
sfm04110  Cell cycle
sfm04218  Cellular senescence
sfm04350  TGF-beta signaling pathway
sfm04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108929121 (tgfb2)
   04350 TGF-beta signaling pathway
    108929121 (tgfb2)
   04068 FoxO signaling pathway
    108929121 (tgfb2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108929121 (tgfb2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108929121 (tgfb2)
   04218 Cellular senescence
    108929121 (tgfb2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108929121 (tgfb2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sfm04052]
    108929121 (tgfb2)
   00536 Glycosaminoglycan binding proteins [BR:sfm00536]
    108929121 (tgfb2)
Cytokines and growth factors [BR:sfm04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   108929121 (tgfb2)
Glycosaminoglycan binding proteins [BR:sfm00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   108929121 (tgfb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 108929121
NCBI-ProteinID: XP_018598981
Position
1
AA seq 409 aa AA seqDB search
MMNCYFVSLFLTLDLLASAAGLSTCSTLDMEQFMKKRIEAIRGQILSKLKLSSPPEQYPE
PGDVSPEIVAIYNSTRDLLQEKAKERAATCERQRSDEEYYAKEVHKIDMQPFFQSENVIP
PTHYNPYFRHLTFDVSSMEKNASNLVKAELRVFRLQNPKARVPEQRIELYQILVHKDLTS
PTQRYIDSKVVQTRTKGEWLSFDVTEAVSEWLLHRDRNSGFKISLHCPCCTFIPSNNLII
PNKSEELEARFAGIDDTFQHSEDQKRRRHAGLTPHLLLMLLPSYRLESQHKNHRQKRALD
AAFCSRNVQDNCCLHSLYIDFKRDLGWRWIHEPKGYNANFCAGACPYLWSADTQHSKVLG
LYNTINPEASASPCCVSQDLEPLTILYYIGKNPKIEQLSNMIVKSCKCS
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgatgaactgctacttcgtgagtctcttcctcaccctggatctgctcgcctcggccgcg
ggtctctcgacctgcagcacgctcgacatggagcagttcatgaagaagcgcatcgaggcg
atccgcggtcagatcctcagcaagctcaagctgtccagcccaccggagcagtacccggag
cccggggacgtgtcgcccgagatcgtggccatctacaacagcacgcgcgacctgctgcag
gagaaggcgaaggagcgcgcggcgacgtgcgagcgccagcgcagcgacgaggagtactac
gccaaggaggtgcacaaaatcgacatgcagcccttctttcagtccgaaaatgtcattcca
ccaacgcactacaacccctacttcagacacctgactttcgatgtgtcttccatggagaag
aacgcctccaacttggtgaaggcagagctccgtgtcttccgtttgcagaaccctaaggcc
cgtgtgccggagcagcgcatcgagttgtaccagattctggtccacaaagacctgacatca
ccaacccagcgctacatcgacagcaaggtggtgcagacacgcacgaagggggagtggctt
tcctttgatgtgacagaagctgtcagcgaatggctgctccacagagacagaaacagtgga
ttcaagatcagcttacactgtccctgctgcacctttatcccatcaaataacttaattatc
cccaacaagagcgaggagctagaagccaggtttgcaggcattgacgacaccttccagcac
agtgaggaccagaagaggcggcgtcacgcagggctgaccccccacctgctgctgatgctg
ctgccctcctaccgccttgagtcacagcacaaaaatcatcggcagaagcgtgctctagat
gcagccttctgctccaggaacgttcaggacaactgctgcttgcactcgctctacatcgac
ttcaagagggatctgggctggaggtggatccatgaacccaaaggttacaatgccaacttc
tgtgctggggcatgtccatacctgtggagcgctgacacacagcacagcaaggtcctgggt
ctgtacaacaccatcaacccagaagcatcagcttcaccctgctgtgtgtcccaggacctg
gagcccctcaccatcctgtactacattggcaagaaccccaagatcgagcagctctccaac
atgatcgtcaagtcctgcaagtgcagctag

DBGET integrated database retrieval system