KEGG   Scleropages formosus (Asian bonytongue): 108929993
Entry
108929993         CDS       T04919                                 

Definition
(RefSeq) N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming) B-like
  KO
K18458  N-acyl-aromatic-L-amino acid amidohydrolase [EC:3.5.1.114]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    108929993
Enzymes [BR:sfm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.114  N-acyl-aromatic-L-amino acid amidohydrolase
     108929993
SSDB
Motif
Pfam: AstE_AspA RRM_1 PDT
Other DBs
NCBI-GeneID: 108929993
NCBI-ProteinID: XP_018600479
Position
16
AA seq 320 aa
METVTMLPLTRVAVCGGTHGNELSGVYLVRELQKNDGGKAEEQGGAAETVSVLKVLSNPR
AVQQCRRYMEKDLNRCFTNALLSTPAGKETLYEIVRAQELNALLGPKGSPEAVDLVCDLH
NTTSNMGLCFISYSQCNWIGPHIFRHLQREISSMPMRYIHLGGPSSEAYSLESVGKCGFG
MEVGPQPHGVVRADIFSAMWDGVRLMLDWIRRFNAGTTFEGGEVEVYTMVKKMDFPRDPE
TESITATIHPELQDRDFRLLCPGDPLFLSFTGETQRYEGEEPLYPLFVNEAAYYEKGIAL
WLARMTKMAFPPIRVKAGAE
NT seq 963 nt   +upstreamnt  +downstreamnt
atggagaccgtcaccatgctgcctctaactcgggtggccgtatgcggtgggactcatggc
aacgagctgtccggcgtctacctggtacgggagctgcaaaagaatgatggcgggaaagcc
gaggagcagggcggggcggcggaaaccgtctctgtgctcaaagtgctctcgaacccgcgt
gccgtgcagcagtgcaggaggtacatggaaaaggatctgaaccgctgcttcaccaacgcc
ctcctcagcacacccgctggaaaggaaactctgtatgaaattgtgagagctcaggagctg
aatgcccttctgggccccaagggcagcccggaggccgtagacctggtgtgtgacctccac
aacaccaccagcaacatgggcttgtgcttcatcagctactcgcagtgcaactggatcggt
ccgcacatcttccggcatctccagagggagatttcctccatgccaatgaggtacatccac
ttggggggtccttcctctgaggcatactcactggagagtgtggggaagtgtggctttggc
atggaggtggggcctcaacctcacggagtggtccgggccgacatcttcagcgccatgtgg
gacggagtgcggctcatgctggactggattcgtcgcttcaatgcaggtactacctttgag
ggaggggaggtagaggtgtacaccatggtgaagaaaatggacttcccccgggacccagaa
acagaatccatcactgccaccatccatccagagctgcaggaccgagactttcgtctcctc
tgtcctggggacccgctgttcctgtccttcaccggggagacccagcggtacgagggggag
gagcctttgtacccactcttcgtgaacgaggctgcctactacgagaagggcatcgctctg
tggctcgcccgcatgacaaagatggctttcccacccatacgggtgaaggcgggtgctgag
taa

DBGET integrated database retrieval system