KEGG   Scleropages formosus (Asian bonytongue): 108930805Help
Entry
108930805         CDS       T04919                                 

Definition
(RefSeq) tryptophan 2,3-dioxygenase A-like
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00380  Tryptophan metabolism
sfm01100  Metabolic pathways
Module
sfm_M00038  Tryptophan metabolism, tryptophan => kynurenine => 2-aminomuconate
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    108930805
Enzymes [BR:sfm01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     108930805
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trp_dioxygenase DUF724
Motif
Other DBs
NCBI-GeneID: 108930805
NCBI-ProteinID: XP_018601736
Position
5
AA seq 403 aa AA seqDB search
MSGCPYFGNSHLSSQTFHREEEDESQEGVNNASKGGIIYGDYLQLEKIVSAQVLQSELRG
NKIHDEHLFIVTHQAYELWFKQILWELDSVRDIFISGHVRDERNMLKVVTRMHRIAMIFR
LLVDQFAVLETMTALDFFDFREYLSPASGFQSLQFRLLENKIGVPDNQRVPYNRRHYRDN
FRGQESEMLLCSEQEPTLLHLVEKWLERTPGLEENGFNFWGKLQKNIEDGLRLEKEKLEK
KEESEEKEEMMAEHNKQREIFTALFDEKRHDHLLSKGERRLSYKALQGALMIYFYREEPR
FQVPFQLLTFLMDIDTLMTKWRYNHVCMVHRMIGSKNGTGGSSGYHYLRSTVSDRYKVFV
DLFNLATFLIPRDWVPKLNPTVHTFLYTAECCDSSYCSSEDSD
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgagtggatgcccatatttcggaaacagtcatctttcatctcagacatttcatcgggag
gaggaggatgagtcacaggaaggtgtcaacaatgccagcaaaggaggcatcatctatggg
gactatttacaactggagaaaatcgtgagcgctcaggtgctgcagagtgagttacggggg
aacaagatccacgatgaacacctcttcattgtcacccatcaagcttatgagttatggttc
aagcagatcctgtgggagctggactccgtgcgggacattttcattagtggccatgtgcgg
gacgagagaaatatgctcaaggtggtgactcgaatgcacaggattgcaatgatcttcaga
ttgctggtcgatcagtttgcagtcctggagaccatgacggccttggacttttttgatttt
agagagtacctgtcacctgcctctgggttccagagcctccagttcagactgctggagaac
aagattggggtgcctgacaaccagcgcgtgccatacaaccggcgacactacagagacaac
ttccgaggccaagagagcgagatgctgctttgctcagaacaggagcccacacttctgcat
ctggtggagaaatggctggagagaactccagggcttgaagaaaatggattcaacttctgg
gggaaactgcagaagaatattgaagacgggctgaggctggaaaaggagaaacttgagaaa
aaagaagagtcggaggaaaaggaagaaatgatggccgagcacaacaagcagagagaaatc
tttactgcactgttcgatgaaaagcgccacgatcatcttttaagcaaaggtgagagaaga
ctgtcttacaaagctctccaaggagctctgatgatctacttttacagggaagaaccgcgt
tttcaagtccccttccagcttctcactttcctgatggacatcgacaccctcatgacaaaa
tggagatacaaccatgtctgtatggttcatagaatgattggcagcaagaacggtactggg
ggatcctctggctatcactatctccgctctacggtcagtgaccgctacaaggtttttgtg
gatttgttcaacctggccacattcttgatcccgcgtgactgggtgccgaagctcaacccc
acggtgcacaccttcctgtacacagcggagtgctgcgacagctcctactgcagcagtgag
gactcagattag

DBGET integrated database retrieval system