KEGG   Scleropages formosus (Asian bonytongue): 108931316Help
Entry
108931316         CDS       T04919                                 

Definition
(RefSeq) BDNF/NT-3 growth factors receptor-like
  KO
K04360  neurotrophic tyrosine kinase receptor type 2 [EC:2.7.10.1]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108931316
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sfm01001]
    108931316
Enzymes [BR:sfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     108931316
Protein kinases [BR:sfm01001]
 Receptor tyrosine kinases (RTK)
  TRK family [OT]
   108931316
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase I-set Ig_3 LRR_8 Ig_2 C2-set_2 ig LRR_5 TPKR_C2 LRRNT
Motif
Other DBs
NCBI-GeneID: 108931316
NCBI-ProteinID: XP_018602527
Position
6
AA seq 858 aa AA seqDB search
MISGLLGTFSTVLISPMFSSTFTWIMLAALFSAMVSWMLVMMFPAMFSPMFSSWMLRMFS
LILSPMFSRMLRMFSRTRRARLRSGLRWGVCGLLLGVCSVGSACPASCTCNSSRVVCVEQ
EPGIEGFPLLQSEVDMENVTEIFIANQSRLSSITYNDLKFYSNLKSLTVTKTELATISPL
AFINNAKLQYLNLKDNRLATLSWKSFQSVNISYLLLGGNPLLCSCGNLWLKHFLGEQADT
QKVYCLEEGVGSRPLSQLAPPACVPPTTMTSPSVITELEGRDVTVICTTSGVPVPTLEWD
TSSIETHRKVDIVMPQATLTLANLSSFDNGREVTCTAENTAGGSESSVLLNVLFAPSILQ
LATPVLDHHWCIPFSVAGNPQPELQWYHEGKMVLEQIYIQTQIHDQSESVYHGCLQLDNP
THINNGKYTLVAKNTFGQDQKTVFAHFMPDIEVEYEVESDLEPADGMAVYVIVGIAALAS
IGFILLLILLKFGRNSKFGMKGSSSVISNDDDSASPLHHVSNGNNTPSEMGSDLVMIGMT
KIPVIENPQYFRSSSHLLQWNSFVRHIKRHNIVLKQELGEGAFGKVFLAECYNLSPEHEK
VLVAVKTLKEASEDGCADFCREAELLTNLQHEHIVTFYGVCVEGEPLVMVFEYMRHGDLN
RFLRSHGPDALLMADQLQSDRTELGPIQMLHIAQQIAAGMVYLACQHFVHRDLATRNCLV
GDNLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYRRFTKESDVWSLGVVLW
EIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCSKEVYDLMLACWQREPHLRMDIKDIH
NRLVNLGQSSPVYLDILG
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atgatctctgggttgctcggaacgttctcaacggtgctgatctccccgatgttctcctcc
acgttcacctggattatgctcgccgcgctgttttcagcgatggtctcctggatgctcgtg
atgatgttccccgcaatgttctccccgatgttctcctcctggatgctcaggatgttctcc
ttgatattgtccccgatgttctccaggatgctcaggatgttctcccggacgcggcgcgcg
cggcttcgctcggggctccgctggggggtctgcgggcttctgcttggcgtctgctcggtg
ggatccgcttgtcccgcatcgtgcacctgcaactcgtcccgggtggtgtgcgtggagcag
gagccgggcatcgagggcttcccgctgctgcagtccgaagtggacatggaaaacgtcacc
gagatatttattgcaaaccaaagcagactctcttccatcacctacaatgacctgaagttc
tactcaaacctcaaaagtctaacggtgacaaaaacagagttggcaactatttccccgctg
gctttcatcaacaatgccaaactgcagtatttgaatttgaaagacaacagactggccaca
ttatcttggaaatcctttcaaagtgtaaacatttcatatttgctcctgggtgggaacccc
ctgctgtgctcctgcgggaacctgtggctcaaacacttcctgggagaacaagcagacact
cagaaggtctactgcctggaggagggtgttggatcaaggcccctctctcagctggcgccc
ccagcatgcgttccaccaactactatgaccagcccgtctgtcatcacggagctagaggga
agggacgtgacggtgatttgtacgacgtccggggttcctgtacccaccctggagtgggac
acgagcagcattgagactcaccgtaaggtggacattgtgatgccccaggccacgctgacg
ctggcaaacctctcctcctttgacaacgggcgcgaggtcacctgcaccgctgagaataca
gctggcggaagcgagtcctcggttctgctcaacgtgctgtttgcccccagcatcctgcag
ctggcgacgcctgtgcttgaccaccactggtgcatccccttcagtgtggcaggaaaccca
cagccagagctgcagtggtaccacgaaggaaagatggtcctggagcaaatttacatccag
acgcagatccacgaccagagtgagagtgtgtatcatggctgcctgcagctggacaacccg
acacacatcaacaatggcaaatacaccctggtggccaagaacacctttggccaggaccag
aagacagtttttgcccactttatgccggatattgaagtggaatacgaagttgagtcggac
ttagagccagctgacggcatggctgtttatgtcattgttggaattgctgctctggcatct
attggatttattctgttgctgattcttctcaaatttggaagaaactccaagtttggaatg
aaaggctcctcctctgtcatcagcaacgatgatgactctgcaagtccccttcatcacgtt
tctaacggcaacaacacaccgtctgaaatgggcagcgatttggtcatgattggaatgacg
aaaatccctgtcattgaaaatccccagtatttccgcagctccagtcacctgctgcagtgg
aacagctttgtacggcacataaagcgccacaacatcgttctgaaacaggagctcggagag
ggggccttcgggaaggtttttctggcagagtgctacaacttgtctccggagcacgagaag
gtcctggtggctgtgaagacgctgaaggaggccagcgaggatggctgtgctgacttctgc
cgtgaggccgagctcctgaccaacctgcagcacgagcacatcgtcaccttctatggcgtg
tgtgtggagggagagcctctcgtcatggtgtttgagtacatgaggcacggtgacctcaac
aggttcctcaggagccacggtcccgacgcgttgttgatggctgaccagctgcagtccgac
cgcaccgaactcgggccgatccagatgttgcacatcgcccagcagattgctgctggcatg
gtgtacctagcctgccagcactttgtgcaccgcgacctggccacccgcaactgccttgtc
ggggacaacctgctggtcaaaattggggactttgggatgtccagggacgtgtacagtact
gactactacagggtcggaggtcacacaatgctgcccatccgctggatgccaccagaaagc
atcatgtaccggaggttcaccaaggagagcgatgtgtggagtctgggcgtggtcctctgg
gagatcttcacctacgggaagcagccgtggtaccagctctccaacaacgaggtcattgaa
tgcatcactcaagggcgcgtcctgcagcgaccgcgcacctgctccaaggaagtgtacgac
ctgatgctggcctgctggcagagggagccgcacttgaggatggacatcaaggatatccac
aaccgcctggtgaatctgggccagagctcaccagtgtatctggacatcctaggatga

DBGET integrated database retrieval system