KEGG   Scleropages formosus (Asian bonytongue): 108931531Help
Entry
108931531         CDS       T04919                                 

Definition
(RefSeq) ankyrin repeat and SOCS box protein 13-like
  KO
K10335  ankyrin repeat and SOCS box protein 13
Organism
sfm  Scleropages formosus (Asian bonytongue)
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sfm04121]
    108931531
Ubiquitin system [BR:sfm04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     108931531
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_4 Ank_2 Ank Ank_3 Ank_5 SOCS_box
Motif
Other DBs
NCBI-GeneID: 108931531
NCBI-ProteinID: XP_018602836
Position
2
AA seq 282 aa AA seqDB search
MEITRARPSLYGDIAHGLGFWTDRSAVHEAAFQGHTLQLQQLIESGASVNIVAVDSITPL
HEACIQGQTQCVRLLLDAGAQVDARNIDGSTPLCDACAAGSLECVKLLLEHGAAVNPTLF
TFSPLHEACMGGNPECVRLMIARGARMEAHDCHFGTPLHVACARQQVDCAKVLLNAGANV
NAAKLHETALHHAAKVKNIDLIEMLVEFGGNVYARDNLGKKPIDYTRPGSSAALCLEFYE
RTPLSLQQLSRVSLRMALGVRALEVVSKLHLPNRIIKYLSYY
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggagattactcgcgccagaccctcgctttacggagacatcgcccatggcctggggttc
tggacggaccgctcagccgtgcatgaggccgccttccagggtcacaccctgcagctgcag
cagctcatcgagagcggcgcgtccgttaacatcgtggccgtggactccatcaccccactg
cacgaggcctgtatacaggggcagacacagtgtgtgaggctgctgctggatgctggtgcg
caggtggacgcgcggaacattgatggcagcacacctctgtgtgatgcctgtgctgcaggc
agtctggagtgtgtgaagttgctgttggaacatggggcagctgtcaatcctactcttttc
accttctcacccttgcatgaggcctgcatgggggggaatccggaatgcgtgcggctcatg
attgccaggggagcccgtatggaggcacatgactgccactttgggaccccgctacacgta
gcctgcgctaggcagcaagtggactgtgcaaaggtgttgctcaatgcaggtgccaatgtc
aacgctgccaaactccatgagacagcactgcaccatgcagccaaagtgaagaacatcgat
ctgattgagatgctggtggagtttggagggaatgtttacgccagggacaacctgggaaag
aagcccattgactacaccaggcccggttcctctgctgcactctgtctggagttttatgaa
agaacacctctaagtctacagcagctgagcagagtctctctgaggatggcgttgggtgtg
agggctttggaggttgtgtccaagcttcacttgcccaaccggataattaagtacctctct
tactactga

DBGET integrated database retrieval system