KEGG   Scleropages formosus (Asian bonytongue): 108931648Help
Entry
108931648         CDS       T04919                                 

Gene name
pah
Definition
(RefSeq) phenylalanine-4-hydroxylase isoform X1
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00360  Phenylalanine metabolism
sfm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sfm00790  Folate biosynthesis
sfm01100  Metabolic pathways
sfm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    108931648 (pah)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    108931648 (pah)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    108931648 (pah)
Enzymes [BR:sfm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     108931648 (pah)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biopterin_H ACT ACT_4
Motif
Other DBs
NCBI-GeneID: 108931648
NCBI-ProteinID: XP_018603101
UniProt: A0A1W4ZRH0
Position
2
AA seq 447 aa AA seqDB search
MDAGFRKVNGETGLQNSMYLEEQTSKSGVLSCIFSLKEEVGALAKALRLFEEKGINLKHI
ESRPSRLNTKEFEFFISVDSACAQSLDDVINALRTQISGNVHELSRDKQKDTVPWFPSNI
QDLDRFANQILSYGSELDADHPGFTDPVYRARRKEFADIAYNYRHGQPIPRVEYTEEEKA
TWGTVFKELKTLYPTHACREHNRVFPLLEKYCGYKQDNIPQLEDVSNFLQSCTGFRLRPV
AGLLSSRDFLAGLAFRVFHSTQYIRHGSKPMYTPEPDICHELLGHVPLFADPSFAQFSQE
IGLASLGAPDEYIEKLATVYWFTVEFGLCKQGTEIKAYGAGLLSSFGELQYCLTDKPKKF
PFEPEKTCIQKYPITEFQPVYFVAESFEDAKEKVRKYAATIPRPFSVRYNAYTQSIEILD
NTQQLTRLADSISGEIGILCNALRKLQ
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggacgcaggattccgcaaagtgaacggggagaccggccttcagaattccatgtatctg
gaggagcagaccagtaagtctggggtcttatcctgcattttctccctgaaggaggaagtt
ggggcgctggccaaggctctccggctctttgaggaaaaaggaatcaacctgaaacacatt
gagtcgcggccgtcccgcttgaacaccaaagagtttgagttcttcataagcgtggactca
gcctgtgcccagtctctggatgatgtcatcaatgccctgcgcacacagatcagcgggaat
gttcatgagctgtcacgcgacaagcagaaggacacagtcccctggttccccagcaacatc
caggacctcgaccgcttcgccaaccagatcctgagctatggctctgagctcgacgccgac
catccgggtttcacagacccggtgtacagagccaggaggaaagagtttgccgacatcgcc
tacaactacagacacggccagcccatcccgagggtggagtacactgaggaggagaaggcc
acttggggcacggtgttcaaggagctgaagactctgtacccgacacacgcctgccgggag
cacaaccgcgtgttcccgctgctcgagaagtactgcggctacaagcaggacaacatcccg
cagctggaggacgtatcgaacttcttgcaatcctgcacagggttccggcttcgccccgtg
gccggcctgctctcctctcgcgacttcctggccgggctggcattccgtgtcttccactct
acgcagtacatccgtcacggatccaagcccatgtacacaccggagccagacatctgccac
gaactcttgggacacgttcctctgttcgccgatccgagcttcgctcagttctcacaggag
attggcctggcttccctcggagctccagatgagtacattgaaaagctggcaactgtctac
tggttcacggtggaattcggactttgcaagcagggcaccgagatcaaggcctatggagct
gggctgttgtcttcctttggggagctgcagtactgtttgacagacaagccgaaaaagttc
cccttcgaacctgagaagacctgtattcagaagtatcccatcaccgaatttcaaccggtg
tactttgtcgcagagagcttcgaggatgccaaagagaaagtgaggaagtacgcggcaacc
attccaaggccgttctcggtgcgttacaacgcgtacacacagagcatcgagatcctggac
aacacgcagcagctcacacgtctggccgacagcatcagtggtgaaataggcattttgtgc
aacgcgctgcgcaaactgcagtga

DBGET integrated database retrieval system