KEGG   Scleropages formosus (Asian bonytongue): 108932960Help
Entry
108932960         CDS       T04919                                 

Definition
(RefSeq) arylamine N-acetyltransferase, pineal gland isozyme NAT-10-like
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00232  Caffeine metabolism
sfm00983  Drug metabolism - other enzymes
sfm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    108932960
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    108932960
Enzymes [BR:sfm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     108932960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2 FBA_2
Motif
Other DBs
NCBI-GeneID: 108932960
NCBI-ProteinID: XP_018605203
Position
5
AA seq 291 aa AA seqDB search
MNLDEYFERICFKGPVHRADLDTLNRVHMNHVLSIPFENLSIHCSEWITMDLDVIYDKIV
RKGRGGWCCENNLLFSWVLKQLGYTFTMLGSRVFNSSINQFSNTDTHLINKVDIDGVSYI
ADVSFGVSGQIWHPLELILGKEQPQEPGVFRFVQEEGMWVLEKTGRKRILQDESFNSSDL
LGSKSKTKKFYSFTLTPRDLNYFLETSNILQTSSDSLFKNKSICSLQTPTGFRALVGWTY
SEVIYNFEEGADLVDMKNIPDHEIQKVLKDKFNISLENKFIPVNSKGCYTL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaatctagacgagtactttgaaaggatttgctttaaagggccggtccacagagcagac
ttggatacactgaatcgtgtgcacatgaaccatgttctgtccattccatttgagaacctc
agcattcactgcagcgagtggatcacgatggacctggatgtcatctacgacaagattgtg
aggaaagggcgtgggggctggtgttgtgaaaacaacctgctgttctcctgggtcctgaaa
cagttgggctacacatttaccatgctgggatccagggtcttcaacagcagcattaaccag
ttcagcaacactgacactcacctaatcaacaaggttgacattgatggtgtttcctacatt
gctgatgtcagttttggggtatctgggcagatatggcaccccctggaactgatcttgggg
aaagaacaaccacaagaacctggagtcttccgctttgtgcaggaggagggaatgtgggtc
ttggagaaaaccggaaggaagcgcatcttacaagatgagagctttaatagttccgatctc
ctgggcagcaagagcaaaaccaaaaaattctatagtttcacattgactccacgtgatctc
aactactttcttgaaaccagcaacattcttcagacctcctctgattctttattcaagaat
aagtccatctgctctctgcagacgcccactgggttccgtgctctggttggctggacctac
agtgaggttatctacaactttgaggagggggctgatctggtggacatgaaaaacatacct
gaccacgaaatacaaaaagtgctgaaagataagttcaacatctctttagagaacaaattt
attcctgttaacagcaaaggttgttacactctttaa

DBGET integrated database retrieval system