KEGG   Scleropages formosus (Asian bonytongue): 108933126Help
Entry
108933126         CDS       T04919                                 

Gene name
phf11
Definition
(RefSeq) PHD finger protein 11
  KO
K23310  PHD finger protein 6
Organism
sfm  Scleropages formosus (Asian bonytongue)
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sfm03000]
    108933126 (phf11)
   03009 Ribosome biogenesis [BR:sfm03009]
    108933126 (phf11)
   03036 Chromosome and associated proteins [BR:sfm03036]
    108933126 (phf11)
Transcription factors [BR:sfm03000]
 Eukaryotic type
  Zinc finger
   Cys4HisCys3 PHD fingers
    108933126 (phf11)
Ribosome biogenesis [BR:sfm03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   108933126 (phf11)
Chromosome and associated proteins [BR:sfm03036]
 Eukaryotic type
  Chromatin remodeling factors
   NuRD complex
    108933126 (phf11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-HC5HC2H zf-HC5HC2H_2
Motif
Other DBs
NCBI-GeneID: 108933126
NCBI-ProteinID: XP_018605472
Position
1
AA seq 414 aa AA seqDB search
METLPTIVCGFCHESEESKITGPILKKNSVVAHENCLFFSSGIYNKNTPDTDDLEGFEEQ
DVIQEMKRGKFLKCHKCKKSGATVGCEVKKCKRSYHYSCAIHDKAQRVENIKKGVFKLYC
ELHRQSPTREINFKNSTAEQSTKTGNSDRAQDLEIPAKRRRQHTLQGHTRKVRRSILYSD
DSSSSDGHEQYDCEQAPLENDLEEKACSVTKQIVKADKTSTYTDEAQPSTSANLSLAYSE
NQDETDIDSDQGSQSLLVPFNIKKVETLAPSPPAPDISPCSSSARPVSLGSHFWSKCHEA
GCLESIFSTFISSMISLSEKILNKQASNEECDLYFKVLIASGVLPDIITRKEQDLKEKMS
SLEKEREALQTALSVISSVSKTSAFPVSHQSGEHRSSEGCSRCQNGTSTPNNPS
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgctgcccaccattgtctgcggattttgtcacgagtccgaggagtcaaagatc
acggggccaattttaaagaaaaacagtgtcgtggcgcacgagaactgcctgtttttttcc
tctgggatttacaacaaaaacacacctgatacagatgacctggaaggatttgaagagcag
gatgtgatacaggaaatgaagagaggcaaatttttgaaatgtcacaagtgcaagaagagt
ggagcaactgttgggtgtgaggtaaagaagtgcaagaggtcttaccactactcctgtgcc
atccatgacaaagcccagagagtggagaacatcaagaagggtgtttttaagttgtattgt
gaattgcaccggcagtcacccacaagagagattaatttcaaaaattccactgctgagcaa
tcaacgaaaactggtaacagcgacagagcacaggacctggaaatacctgccaagagaaga
agacaacatactttacagggtcataccagaaaagttaggaggagcatcctgtactcagat
gattcttctagctcagatggtcatgagcaatatgactgtgaacaagcacctttggagaat
gatttggaagagaaggcatgttcagtaacaaaacaaattgttaaagctgacaaaacaagt
acctatacagatgaagcacagccttccacttcagcaaatctctcattggcttacagtgaa
aaccaagatgagactgatatcgattctgaccagggttcccagagccttctggtgccgttc
aatatcaagaaggtggagactcttgccccgtctcctccagctccagacattagtccttgt
tccagttctgcaaggccagtgagtttgggctcccacttctggtccaaatgccatgaagcg
ggctgccttgagtctatcttctccaccttcatctcatccatgatcagcctttctgaaaag
atcctgaacaagcaagccagtaatgaagagtgtgatctctatttcaaagtgctgatagcc
tcaggagtgctgcctgacataataaccaggaaagaacaagacttaaaggaaaaaatgtca
agtcttgagaaggagagggaagcattacaaacggccctgtccgtaataagcagcgtgagt
aaaacaagtgccttcccagtcagtcaccagtccggtgaacaccgttccagtgaaggatgc
agccgttgccagaacggtaccagcacacccaacaacccatcctaa

DBGET integrated database retrieval system