KEGG   Scleropages formosus (Asian bonytongue): 108934058Help
Entry
108934058         CDS       T04919                                 

Gene name
dpp3
Definition
(RefSeq) dipeptidyl peptidase 3 isoform X1
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sfm01002]
    108934058 (dpp3)
Enzymes [BR:sfm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     108934058 (dpp3)
Peptidases [BR:sfm01002]
 Metallo Peptidases
  Family M49: dipeptidyl-peptidase III family
   108934058 (dpp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M49
Motif
Other DBs
NCBI-GeneID: 108934058
NCBI-ProteinID: XP_018607062
UniProt: A0A1W4ZTS2
Position
Unknown
AA seq 769 aa AA seqDB search
MNRKLCSTFVGFAVQFRRACVLSCRLHKQLHCVSVRKHHHCTMVDSQYYLPNDIGISALD
CAEAFRLLSPKEKLYAHYLSRAAWYGGLVVLLQTSSESASIYVLLQRVFRQQSPAQLESV
AMDAGLSPEEYQAFLVYAAGLYANMGNYKSFGDTKFVPNLSKEKLKALLWQSQAFKDSPT
EMEALWNSSADLIYSLEDRQKQLGLGDKGITTYFSGNCCLEDAELAQKFLDSKNLSAYNT
RLFKREAVAGKNSYEVRLASSVQNDCVVDGETDTRCGKYEFGEAVFTVRRGDYAPLMKKV
SENLEKAQAYAANENQRRMLEEYVRSFTFGSVEAHKEGSRYWIKDKGPIVESYIGFIESY
RDPFGSRGEFEGFVAIVNKAMSARFGQLVSSAEVLLPELPWPSAFEKDTFLKPDFTSLDV
LTFAGSGIPAGINIPNYDDIRQTEGFKNVSLGNVLAVAYATQKEKLTFLDEKDKDLYIKW
KGPSFEVQVGLHELLGHGSGKLFVQDEKGNFNFERQNVRNPETGELISSWYKGNETWDSK
FSTIASSYEECRAECVGLYLCLNKQVLSIFGHEGEDAEDVVYVNWLTMVRAGLLGLEFYT
PDSQSWRQAHMQARFVILRVLLETGEGLVTLQETTGADGRPDALITLDRAKIHTVGKSAI
QRFLCKLQVHKSTADVDGGRALYDRYSAVTSSGSHDFLRLRETVLLRKEERKMFVQANTR
INGETVELVEYEGSATGLIRSFAEKFPEDAEEVESQLLELSKQDASCWC
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atgaataggaaactttgttctacgttcgtaggcttcgcagtccagtttcgtcgagcttgt
gtgctcagctgccgtcttcataagcaactacattgtgtgagtgtgagaaagcatcatcac
tgcaccatggtggactcccagtattacctccccaatgacattgggatctcagctctggac
tgtgccgaggctttccgccttctctcgcccaaggagaagctctacgctcattacctctct
cgggcagcctggtacggaggcttggtcgtgctactccagacctcctctgagtcggcctcc
atctacgtcctgttgcagagggtcttccgccagcagtcacctgcgcagctagagagtgtt
gccatggatgcagggctcagcccagaggagtatcaggctttcctggtgtatgctgctggc
ctgtacgctaacatgggtaactacaagtcttttggtgatacgaagtttgttcccaacctc
tcaaaggagaagttgaaagccttgttgtggcagagtcaggcttttaaggacagccccacg
gagatggaagctctgtggaatagcagtgctgaccttatctattctctggaggaccggcag
aagcagctaggactaggcgataagggaatcaccacatacttctcagggaactgttgctta
gaagatgcagagctggcccagaaatttctggactctaagaacctgagtgcctacaatact
cggctgtttaaaagagaggctgtcgccggaaaaaattcttatgaagtgcgcctggcttct
tctgtgcagaatgattgtgtggtggatggagagacggacactcgttgtggcaagtatgag
tttggagaggccgtgttcacagtgcggagaggcgactacgctccgctcatgaagaaagtg
agcgaaaacttggagaaagctcaggcatacgctgccaatgagaaccagcggcggatgttg
gaggagtatgtgcgcagtttcactttcgggtctgtggaggctcacaaggagggctcccgg
tactggattaaggacaaagggcccattgtggagagttacattggattcatcgagagttac
agggacccgtttggatccagaggagaatttgaagggtttgtggcgatagtgaacaaagcc
atgagcgcacgtttcggtcagctggtgagctcagccgaggtactgcttccagaactgcct
tggccgtcggcttttgaaaaagacaccttcctgaaacctgacttcacgtccttggatgtg
ctgacgtttgccggcagtggcattccggccggcatcaacattcccaactatgatgatatc
cgacaaacggagggcttcaagaatgtgtcgctgggaaacgttcttgctgtggcctacgca
acacagaaagagaaactcaccttcttggatgagaaggacaaggacttgtacatcaagtgg
aaaggtccatcttttgaagttcaggtgggactccacgagctgctgggccatggcagcgga
aagctctttgttcaggacgagaagggaaatttcaactttgaacggcaaaacgtccgcaat
cctgagactggagaactgatatccagctggtacaaaggaaacgagacatgggacagcaag
ttttctactattgcgtcttcctacgaggagtgcagagccgagtgcgtcggactctacttg
tgccttaacaagcaggtgctcagcatatttgggcacgagggtgaggacgcagaggacgtg
gtgtatgtgaactggctcaccatggtgcgtgctggcctcctgggcctcgagttctacacc
ccagacagccaaagctggagacaggcccatatgcaggcacgttttgtcatcttgcgcgtg
ctgcttgagactggagaaggcctggtcacgctgcaggagaccaccggagcagatgggcgg
cccgatgcccttatcaccctggaccgtgcaaagattcacactgtgggcaaaagtgccatc
cagaggttcctctgcaaactgcaggttcataagtcaacggccgatgtggatgggggtaga
gcactctatgaccgctactcagccgtaacctcctcggggtcacatgacttcctgcgtttg
cgagagactgtgcttctgcggaaggaagagcgcaaaatgtttgttcaggccaacactcgg
atcaacggcgagaccgtggagttggtggagtacgagggcagcgccacagggctgatccgc
tcctttgccgagaagttccctgaagatgctgaggaggttgagtcccagctgctggaacta
agcaagcaagacgcctcctgctggtgctga

DBGET integrated database retrieval system