KEGG   Scleropages formosus (Asian bonytongue): 108934264
Entry
108934264         CDS       T04919                                 

Definition
(RefSeq) deoxycytidine kinase-like isoform X1
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00230  Purine metabolism
sfm00240  Pyrimidine metabolism
sfm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    108934264
   00240 Pyrimidine metabolism
    108934264
Enzymes [BR:sfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     108934264
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 AAA_28 Thymidylate_kin AAA_17
Other DBs
NCBI-GeneID: 108934264
NCBI-ProteinID: XP_018607361
UniProt: A0A0N8K113
Position
4
AA seq 264 aa
MATPPKRICSSPVFDNSFEKRTKKISIEGNIAAGKSTLVRLLEKSSEEWEVIPEPIGKWC
NVQTTENEYEELSTSQKSGGNLLQMLYDKPSRWSYTFQSYACLSRVRSQLQLPSIKLQQA
EKPVQFLERSVYSDRYVFASNLFESGDLNETEWTIYQDWHSWLLSQFESQIELDAMIYLR
ADPQRCMQRLHLRGREEEQGIPLEYLEKLHYKHECWLYHRTTYLDFEYLKDLPVLVLDVN
EDFKYDKIKQVDVIDKVKEFLDTL
NT seq 795 nt   +upstreamnt  +downstreamnt
atggcaactcctcctaagagaatatgctcgagtccagtctttgacaacagttttgaaaag
aggactaagaaaatttccatcgagggcaatattgctgctggaaaatccacgcttgtccgt
cttctggagaaatcctcggaggaatgggaggtgattccagagcccatcggaaagtggtgc
aacgtacaaactaccgaaaatgaatacgaggaacttagcacttctcagaagagcggaggc
aacttactgcaaatgttgtacgacaaacctagtcggtggtcttacactttccagagctac
gcgtgcttgagtcgtgtgcgctcacagctgcaactaccctccatcaaactacagcaggca
gagaaacctgtgcagttcctggagcgctcagtctacagcgatcggtatgtgtttgcttcc
aatctgtttgagtccggggacctaaatgagacagaatggaccatttaccaggactggcac
agctggcttctctcccagtttgagtcgcagattgagctggatgctatgatttatctgaga
gctgatccacagagatgtatgcaacgactgcatcttcgaggacgagaggaagaacaggga
attcctctggaatacctagaaaaactgcattataagcatgagtgctggctttaccaccgt
acaacctacttggattttgagtacctgaaagatcttcccgttcttgtccttgatgtgaat
gaagatttcaagtatgacaaaattaagcaagtagatgtcatagacaaggtaaaggagttt
ctggacaccctttaa

DBGET integrated database retrieval system