KEGG   Scleropages formosus (Asian bonytongue): 108934427Help
Entry
108934427         CDS       T04919                                 

Definition
(RefSeq) glutamate receptor 1-like isoform X1
  KO
K05197  glutamate receptor 1
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108934427
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:sfm04040]
    108934427
Ion channels [BR:sfm04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   108934427
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lig_chan ANF_receptor Lig_chan-Glu_bd SBP_bac_3 Pex14_N DUF4834 DUF2061
Motif
Other DBs
NCBI-GeneID: 108934427
NCBI-ProteinID: XP_018607752
Position
4
AA seq 929 aa AA seqDB search
MRRMFPLLCTISFLGLCSATSFPSNINIGGFFPSGSHEYEVFRFALLQHQDVPKLVPQVD
MVNISDSFEMTYAFCSQFSKGVYAIIGLYDRQTVNMLMSFCGALHVCFITPSFPIETSNQ
FVIQLRPEIQDALVAVIEHYRWTKFVYMYSSHSGMTALQKVLDTAAEKNWMVTSINLLTM
TEAAFLKVLQDLDKKKEGQIIMDCELDRLSSILNLIAAQGRNLKSYHYILANLGFTDIDL
TEFRKAGANVTGFQLMNYTDPSISRTIQEWLEFDSKDLKAPKKRLKYTGALTYDGVSVMA
AAFQNLRKQRIDISRRGNAGDCLANPPAPWGQGIDIQRALQQVQIEGLTGHIQFNEKGRR
TNYTVSVMELSPDGPKKVGYWNEEEKYVSTATYSHGSNETFGLQNRTYIVTTILESPYVM
LKKNHDQLVGNDKYEGYCVELAAEIAKHVGYTYKLEIVPDGKYGARDSETKMWNGMVGEL
VYGKADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPTKSKPGVFSFLDPLAYEIWM
CIVFAYIGVSVVLFLVSRFSPYEWHGDEPEEGEEQQESQTQSQGQSQPPQSPQSPNRESQ
SQAQQNQVQQQSQEHTNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLII
ISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDGGSTKEFFRRSKIAVFEKMWS
YMKSAESSVFVKTTEEGVLRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGY
GVATPKGSPLRNPVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNV
AGVFYILIGGLGLAMLVALVEFCYKSRTESRRMKQIISDAMLSSTLSRMNRNESGGENGR
IVTHDFPKEAQTLPCMSHAAGMGLGVSGM
NT seq 2790 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgaatgttccccttgctctgcaccatcagctttcttgggctttgttccgctacg
agtttcccaagtaatataaacataggggggttcttccccagcggctcccacgaatatgag
gtgtttcgctttgcgctcctgcagcaccaggacgtccctaaactggtacctcaggtggac
atggtcaacatctcggatagctttgaaatgacatacgcattttgttcgcagttctccaaa
ggtgtatacgccatcattggactctacgataggcagacggtgaacatgctcatgtccttc
tgcggggctctgcacgtctgcttcatcactcccagcttccccattgagacatccaaccag
ttcgtgatccagctgcgtccggagatacaggacgccctggttgcagtcattgaacactac
aggtggaccaagttcgtctacatgtacagctctcactcaggaatgacagctttgcagaaa
gttctggacacagctgctgagaagaactggatggtgacctccataaatctcttgacaatg
acggaggcagcctttctaaaggtgctccaggacctcgataagaagaaggagggacaaatc
attatggactgtgagctggacaggctttcttcaatcctgaatctgattgcagctcagggg
aggaacctgaaaagctaccattacatactggcaaacctgggcttcacggacattgacctg
acggagtttaggaaggccggcgccaacgtgacgggcttccagctgatgaactacactgac
cccagcatcagccgaacgatacaggagtggctcgagtttgacagcaaggacctcaaagct
cctaagaaacggctcaagtatactggggccctcacctatgatggtgtgagtgtgatggct
gccgccttccagaacctccggaagcagcgcattgacatttctcgccgaggcaacgccggc
gactgtctggccaaccccccagcaccatgggggcagggtatcgacatccagagagctcta
caacaggttcagatagaaggcttgacaggacacatacagttcaatgagaaaggacgacgc
accaactacaccgtcagtgtaatggagctgagtccagatggacccaagaaggttggatac
tggaacgaagaagaaaaatatgtgagcactgcaacttactctcacggcagcaacgaaaca
ttcggattgcaaaacaggacttacattgttactactatattggaatctccgtatgtgatg
ctgaaaaagaaccacgatcagctggtgggaaacgataagtacgagggctactgcgtggag
ctggcggcggagattgccaagcacgtcggctacacttataaactggaaattgttccggat
gggaagtacggagccagagattctgaaaccaagatgtggaacggcatggtgggggagctg
gtgtatggcaaagcggatgtggctgtggccccgctgaccatcacacttgtgcgggaggag
gtcatcgatttctctaagcccttcatgagcttggggatctccatcatgatcaagaagccc
accaagtccaagcccggagtgttctcattcctggaccctctggcctatgagatctggatg
tgcattgtgtttgcctacataggcgtgagcgtggttctcttcctggtgagccgcttcagc
ccgtacgagtggcacggcgacgagccggaggagggtgaggagcagcaggaatcgcagacg
cagtcccaggggcagtcgcagccaccacagagcccacagtcgccaaaccgggagagccag
tcccaggcccagcagaaccaagtacaacagcaaagccaggaacacacaaatgagtttggg
atcttcaacagtctttggttctcccttggagccttcatgcagcaaggctgtgacatctcg
cccagatctctctctggccgcatagtggggggtgtctggtggttcttcaccctcatcatc
atctcctcctacacggccaaccttgccgccttcctcacagtggagaggatggtgtctccc
attgagagtgccgaggacctggccaagcagacagagatcgcctacggcaccctggacggt
ggttccaccaaagagttctttaggaggtcaaagattgctgtgtttgagaagatgtggtcc
tatatgaagtctgcggagtcctccgtgtttgtgaagacgaccgaggagggtgtgctcagg
gtgagaaagtccaaagggaagtacgcctacctgctggagtccaccatgaatgagtacatc
gagcagcggaagccgtgtgacaccatgaaggtgggcggcaacctggactctaaaggatat
ggtgtggccactcctaagggttcacctttaagaaatccagtaaacctggcagtgttaaaa
ctgaacgagcagggcctcttggacaaattgaaaaacaaatggtggtacgacaagggagag
tgcggcagcgggggaggtgactccaaggacaagacaagtgctctgagcctcagtaatgtg
gctggagtgttctacatcctgattggagggctggggctagccatgctcgtagcactcgtg
gagttctgctacaagtccaggacggagtcgaggcgaatgaagcaaatcatcagtgacgcc
atgctgagctccaccctgagcagaatgaacaggaacgagagcgggggtgagaatgggcgg
atagtgacgcacgactttcccaaagaggcacagactctgccgtgcatgagccacgcggct
ggtatgggccttggcgtctcgggcatgtga

DBGET integrated database retrieval system