KEGG   Scleropages formosus (Asian bonytongue): 108935320Help
Entry
108935320         CDS       T04919                                 

Definition
(RefSeq) aldehyde dehydrogenase family 9 member A1-A-like
  KO
K00149  aldehyde dehydrogenase family 9 member A1 [EC:1.2.1.47 1.2.1.3]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00010  Glycolysis / Gluconeogenesis
sfm00053  Ascorbate and aldarate metabolism
sfm00071  Fatty acid degradation
sfm00280  Valine, leucine and isoleucine degradation
sfm00310  Lysine degradation
sfm00330  Arginine and proline metabolism
sfm00340  Histidine metabolism
sfm00380  Tryptophan metabolism
sfm00410  beta-Alanine metabolism
sfm00561  Glycerolipid metabolism
sfm00620  Pyruvate metabolism
sfm01100  Metabolic pathways
Module
sfm_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108935320
   00053 Ascorbate and aldarate metabolism
    108935320
   00620 Pyruvate metabolism
    108935320
  09103 Lipid metabolism
   00071 Fatty acid degradation
    108935320
   00561 Glycerolipid metabolism
    108935320
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    108935320
   00310 Lysine degradation
    108935320
   00330 Arginine and proline metabolism
    108935320
   00340 Histidine metabolism
    108935320
   00380 Tryptophan metabolism
    108935320
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    108935320
Enzymes [BR:sfm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     108935320
    1.2.1.47  4-trimethylammoniobutyraldehyde dehydrogenase
     108935320
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 108935320
NCBI-ProteinID: XP_018609341
Position
9
AA seq 511 aa AA seqDB search
MAQLLRTPLLSPAVIQGASTGTLEVKGPLSFWGGGRANPLDTKHAEPVYEPATGRVLCEL
VPCGPEEVDQAVKSAHAAYLKWSKMSGMERAHVMLEAARLIRERKDEIAKVEVINNGKSI
IEATGNVQGAAQCIEYFAGLAGTLAGQHIQLSGNAFAYTRREPLGVCLGIGAWNFPFTIA
VMKSAPALACGNAMIYKPSPMTPLTTVMLAEIYTQAGVPEGLFNVVQGGAETGSLLCHHP
MVAKVSFTGSVPTGKKVMEISAKGVKPVTLELGGKSPLIIFKDSELENAVKGALMGNFLT
QGEVCCNGTRVFVQREIMPQFLEEVVKRAKTITVGDPMQIATRMGALISRPHLERVLGFI
SQAKKEGARVLCGGEPFVPNDPNLKGGYFMSPCVLDNCRDDMTCVKEEIFGPVMSVLPFD
TEEEVIERANNTTFGLAAGVFTRDIARAHRVVENLQAGTCFINNYNKTSVELPFGGYKMS
GIGRENGQVAVEYYSQLKTVVVEKGDVESLF
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggcccagctgctgcggactcccctgctctcccctgctgtgatccagggtgcctccact
ggcaccctggaggtgaagggacccctcagtttctggggtgggggcagagccaacccactg
gacacaaaacatgccgaaccggtttatgagcctgctaccggccgtgttctgtgcgaattg
gttccatgtggacctgaggaggtagaccaagctgttaaaagtgctcatgctgcgtatctg
aaatggagtaagatgtcgggtatggaaagggcccatgtgatgctggaggctgcacgcctt
atcagggaacggaaagatgagattgccaaggttgaggttatcaacaatggcaaatccatc
atagaggcaactggaaatgtacaaggtgctgcacagtgcattgaatactttgctggcctc
gctggcacattggcaggccaacatatccagctttcaggaaatgcctttgcgtatacacga
cgtgagcccttgggagtgtgtctgggtattggggcttggaacttccccttcaccattgca
gttatgaaatctgcccctgcccttgcctgtggcaatgccatgatatacaagccctctccc
atgacccccctgacaacagtcatgctggcagaaatctacacccaggcaggcgttccagag
gggctcttcaatgtggttcagggtggagcagaaacgggttctctcctctgtcaccacccc
atggtggccaaggtttcctttactggaagtgttccaaccggcaagaaggtaatggagata
tctgctaaaggtgtgaaacctgttactttggaactgggaggaaagtctccgctcatcatt
ttcaaggacagtgagctggaaaatgctgtgaagggggctcttatgggtaatttccttacc
cagggggaggtgtgctgtaatggaacaagagtctttgtccagagggagatcatgccccaa
ttcctggaggaggtggttaagagggcaaagaccattactgtaggggaccccatgcaaatt
gcaactcgtatgggggctctgatcagccggccacatctggaaagggttctgggttttata
agccaggccaaaaaagagggggccagagtgctttgtggtggggaaccctttgttcccaat
gaccccaacttaaagggtggctattttatgtctccttgtgtgttggataactgcagagat
gacatgacatgtgttaaagaggagatctttgggcctgtcatgtctgtgcttccctttgac
actgaggaggaagtaattgaaagagccaataacacaacatttggcttggcagctggggtc
ttcacaagggacatagcacgtgcccatcgtgtagttgaaaaccttcaggcagggacctgt
ttcatcaacaactacaacaaaacatctgtggagctgccttttggaggctataagatgtca
ggtattggtcgagaaaatggccaggtggcagtcgagtactattcacaactgaagactgtg
gtagttgagaagggtgatgtggaaagtctcttctaa

DBGET integrated database retrieval system