KEGG   Scleropages formosus (Asian bonytongue): 108935419
Entry
108935419         CDS       T04919                                 

Definition
(RefSeq) aryl hydrocarbon receptor repressor-like
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
sfm  Scleropages formosus (Asian bonytongue)
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sfm03000]
    108935419
Transcription factors [BR:sfm03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    108935419
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9 PAS_4
Other DBs
NCBI-GeneID: 108935419
NCBI-ProteinID: XP_018609513
Position
9
AA seq 662 aa
MIPPGDCMYAGRKRRKPIQKQKPAVVSEKSNPSKRHRDRLNAELDRLASLLPFSPDVISK
LDKLSVLRLSVSYLRVKSFFQAIQEKPSRIPISPSTHPDMGKESQPGPTVAESELLLESL
TGFALVVSTDGMVFYASSTIVDYLGFHQTDVMHQNIFDYIHVDDRQEFRRQLHWAMNPTQ
QLATLDPHLVAGAGEDFAVNNLFNSPESGGIPPEYSSFLNRCFISRVRCLLDSTSGFLTM
QFQGRLKFLYGQKKKTPSGTALPPQLALFCVAVPLLLPSITEMKMKTVMMRGKQRSGLLA
VLDHSEREEHLRRPPGHGGEALLLSCPGNPGGPARSHGSWTALAREGTGTKCKSEVYYAQ
EEPLNFCKSSTSGHRAPGFEQGMWTARATSGAVRVGQNISYIPSRLGKPGAYRMSPNCHP
ARNDIYLPKLYNSPQNLEVENFCVESIKSENRYMPPGEGYDGRLLPEMPIKVEQDSDSEN
GCDIYGIPHGRAWTYKEHMEKRYGTGYDGLQLKTEAEYYEQFSPCQKSKAVSPTFNGHYP
GMCITGSRPLKCVLNKDLSQFSPQRLVNSDPLCSHQSANCMESHMHGEGPMDHKSYAHQD
YKFGYDFKGHGLLHSIKREPMDSPPWSDGANDINYATTQRNVMSNCVMSAGAHKSNPYIY
MQ
NT seq 1989 nt   +upstreamnt  +downstreamnt
atgattccaccgggggactgcatgtatgctggcagaaaaagaaggaagcccattcagaaa
cagaagccagcagtggtgagcgagaagtccaacccgtctaagcgtcaccgtgaccggtta
aacgcagagctggaccgcctggccagcctgctgcccttctctcccgacgtcatctcgaag
ctggacaaactgtctgttctgcggctcagtgtcagttacctaagggtcaagagcttcttc
caagctattcaggagaaaccatcaaggattcccatcagcccatctactcaccctgacatg
ggcaaggaaagccagcctgggcccactgttgcagagagcgaacttttactggagtccctt
actggctttgcattggtggtaagcacagatgggatggtgttttatgcctcatccaccatt
gtggactacttgggcttccatcagactgatgtgatgcaccagaacatctttgactacatc
catgtggacgaccggcaggagttccgaaggcagctccactgggccatgaatcccacgcag
cagctggcaaccctggaccctcacttagtggcgggagcaggtgaggactttgcggtgaac
aacctgttcaactcccccgagtctgggggcatccccccagagtactcctcctttctcaac
cgctgcttcatctcccgggtgcgctgcctgctggacagcacatcaggcttcctgaccatg
cagttccaggggcggctcaaattcctctacggccagaaaaagaagacgccatcgggcaca
gccctgcccccacagctggcactcttttgcgtggccgttcctctgctgctgccttctatc
actgagatgaagatgaaaaccgtaatgatgaggggcaagcagaggagcgggctgcttgct
gtgctggaccacagtgaaagagaggagcacttgaggaggccccctggccatggtggggaa
gcactgctgctcagctgccctggcaacccagggggaccagcacgcagtcatgggtcctgg
acagcacttgcacgggagggtaccggcaccaagtgcaagagtgaggtctactatgcacag
gaggagcctctgaacttctgcaagtcatccacgagtggacacagagccccaggctttgag
caaggcatgtggacagctagggccacctcgggcgcagtgagggtggggcagaatataagt
tacatccccagtcgactcgggaagcccggagcgtacaggatgtctcccaattgtcaccca
gccaggaatgacatctatctgcccaagctgtacaatagcccgcagaacttggaggtggag
aacttttgcgtggaaagcattaagagtgagaataggtacatgccaccaggtgagggatat
gatggccgcttgctccccgaaatgccaatcaaagtggagcaggactcggactcagagaac
ggatgcgatatctacggcatcccgcatggccgggcgtggacatataaggagcacatggag
aaacggtacggcacaggctacgatggcctccagctgaagacagaggctgaatactacgag
caattctcaccctgccagaagagcaaggctgtgagcccgacatttaacgggcactatcca
ggcatgtgcataacaggcagcaggcccttaaaatgcgttctgaacaaagacctgagtcaa
ttcagccctcagcggctggtaaactctgatcccctctgcagccaccagagcgcaaactgc
atggagagccacatgcatggagagggtcccatggatcacaaaagctatgcgcaccaggac
tacaagtttggttacgacttcaagggccatggtctcctgcactccatcaaacgggaaccc
atggactccccgccctggtctgatggtgcgaatgatatcaactatgcaaccacgcagaga
aatgtcatgtcgaactgtgtcatgagtgcaggggcacacaaatcaaacccttacatctat
atgcagtga

DBGET integrated database retrieval system