KEGG   Scleropages formosus (Asian bonytongue): 108935643Help
Entry
108935643         CDS       T04919                                 

Gene name
znrd1
Definition
(RefSeq) DNA-directed RNA polymerase I subunit RPA12
  KO
K03000  DNA-directed RNA polymerase I subunit RPA12
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    108935643 (znrd1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sfm03021]
    108935643 (znrd1)
Transcription machinery [BR:sfm03021]
 Eukaryotic type
  RNA polymerase I system
   RNA polymerase I
    Pol I specific subunits
     108935643 (znrd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TFIIS_C DZR DUF3716 zf_UBZ A2L_zn_ribbon Zn_Tnp_IS1595
Motif
Other DBs
NCBI-GeneID: 108935643
NCBI-ProteinID: XP_018609920
Position
23
AA seq 118 aa AA seqDB search
MSTFSGDHSFCPECGCVLPLPGLEETVTCPRCRFTVSIHEFADKAVTSSVVFNPLEASSF
PKEEEEEAELKGPVIDRRCSRCNKEGMVYHTRQMRSADEGQTVFYTCIHCRFQEKEDS
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgtctaccttcagcggagatcacagcttctgccctgaatgcggctgcgtgctgcccctg
cccggcctggaggagacggtcacatgcccccggtgccgcttcacggtgtccatccacgaa
ttcgcagacaaagcggtcacatcatcagtggtgtttaaccctttggaagcctcttctttt
ccaaaggaagaggaggaggaggctgaactcaagggaccagtgatcgacaggcgatgctcc
cgctgtaacaaagaggggatggtgtatcatactagacagatgaggtctgcggatgaaggg
cagacggtcttctatacatgcatacattgcaggttccaagagaaagaggattcttaa

DBGET integrated database retrieval system