KEGG   Scleropages formosus (Asian bonytongue): 108937227Help
Entry
108937227         CDS       T04919                                 

Definition
(RefSeq) voltage-dependent calcium channel gamma-3 subunit-like
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm04010  MAPK signaling pathway
sfm04260  Cardiac muscle contraction
sfm04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108937227
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    108937227
   04261 Adrenergic signaling in cardiomyocytes
    108937227
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:sfm04040]
    108937227
Ion channels [BR:sfm04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   108937227
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-GeneID: 108937227
NCBI-ProteinID: XP_029110137
Position
8
AA seq 311 aa AA seqDB search
MESREAQITMCDRGVQMLVTTVGAFAAFSLMTIAVGTDYWLYSRGVCRIKTPGENETNRK
NEEVMTHSGLWRTCCLEGAFRGICKKIDHFPEDADYEQDAAEYLLRAVRASSIFPIISVG
LLFMGGLCVAASEFYRSRHNVILSAGIFFVSAGLSNIIGIIVYISANSGDPSQRDAKKSY
SYGWSFYFGALSFIMAEMVGVLAVHMFIDKHRQLRAQSRVELLKKPPAPGHHRRFRRRSR
SAEPASRDDSPTGQGYGGPGSADISMYTLSRESGKASAASLLNSDREYLQAQKDYQDTLQ
REAANRRTTPV
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggagagcagagaagcccagatcacgatgtgtgaccgaggggttcagatgctcgtcacc
acagtgggcgccttcgccgccttcagcctcatgaccatcgccgtgggtaccgactactgg
ctctattcccggggtgtgtgtcggattaagacgccgggggagaacgagaccaatcggaag
aacgaggaggtgatgacccactcggggctctggaggacctgctgcctggaaggtgcattt
cggggaatctgcaagaagatagaccattttccagaggatgctgactatgagcaggatgcg
gccgagtacttactgcgcgctgtgagggcctccagtatcttccccatcatcagcgtgggc
ctgctcttcatggggggactctgcgtggcggcaagtgagttctacaggagccggcacaac
gtcatcctcagcgcagggatcttcttcgtgtcggccggtctaagcaacatcattggcatc
atcgtgtacatctcagccaactccggggacccgagccagcgtgacgccaagaagagctac
tcctacggatggagcttctacttcggcgcgctgtccttcatcatggctgagatggtgggc
gtcctggccgtgcacatgttcatcgacaaacaccggcagctgcgtgctcagtcgcgtgtc
gagctccttaaaaagccgcccgcccccgggcaccaccgccgcttccgccggcgctcccgc
tcggccgagccggcctcccgcgacgactcacccactggccagggctacggtggccccggc
tctgccgatatctccatgtacacgctgtcacgggagtccggcaaggctagtgctgcctcg
cttctcaactcagacagggagtacctacaggcccagaaggactaccaggacacgctacag
cgggaggcggccaatcggaggaccaccccagtgtga

DBGET integrated database retrieval system