KEGG   Scleropages formosus (Asian bonytongue): 108938135
Entry
108938135         CDS       T04919                                 

Gene name
adamts13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sfm01002]
    108938135 (adamts13)
Enzymes [BR:sfm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     108938135 (adamts13)
Peptidases and inhibitors [BR:sfm01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   108938135 (adamts13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin TSP1_CCN Reprolysin_3 Reprolysin_5 Reprolysin_4 TSP1_spondin Reprolysin_2 ADAM_spacer1 Peptidase_M10
Other DBs
NCBI-GeneID: 108938135
NCBI-ProteinID: XP_018614008
Position
17
AA seq 1527 aa
MAAALLLWVLWVLPASTLSRRSSAEEYFLQFLDQQDLLFYFGTTSIASVPDFQLVWPRCP
STEPSITPWRCSVEAQGRRYELGLPGGGSPPSCFSLEDVVLDCCARLRVLKPQSAHANLT
FCGGSLRGLLLTQGTWLHIQPVLQRHQQLAGSSDGPPATAHLVFPRPVFEGSSQGLPRSN
VRLKRSSTMGSQVTHLELLVVAGPDVQQVHRQDTERYILTNLNIASELLRDISLGASLRV
HLIRIIILTEPEPEIQITGNITSSLMSVCQWGHRVNPTNDTDPLHADLLLYITRFDLQLP
DGNKQVRGVAQLGGACSSQWSCVITEDTGFDLGITIAHEIGHSFGINHDGTGNTCSSSGF
IMASDGGYNSVDLSWSQCSRDQLQSFLSSDHGECVKDLPLLGGSLQDWKPGLYYGIDDQC
RIAFGNVARACSFNTGDIDMCRVLSCHVVPGDQSSCTRLLVPLLDGTECAPNQWCLKGRC
VSPSQLSSSMAVHGSWSSWSEFSPCSRTCGGGVSARRRQCNNPRPAFGGNNCKGPDTEAE
LCNMQPCPRTQLEFMEEQCSMTDSQPLYLSSSDATGYHWISAVGYVTGDLQCKLMCRSQG
EDFMVSRGARFVDGTRCEPSSLAPTGSVSACLAGTCQLFGCDGLLNSGKVKDACGVCGGD
GSSCSLVSDSYTEGHAKEYTTFLTLPQNATQVHIVNTRPIFTHLAVLVQGKYVVAGTGSV
SLNTTHPSPLEDGRLTYLLYLTPDLLPHKEELLLPGPVEEDIHIQVYRKYGKEYGEATSP
NISYSFYAPGTASKTRAKWTTRMTTCSVTCGSGTQQTIALCVSEDGDEHLSETSCEATPR
PPFLEVPCHLAACPPYWETGDFGPCSVSCGGGEMVRSVRCVQRQGAELLQRPASECPQDS
APPSLSACSPEPCPARWRVSNPGECSAACGPGTAWRVVSCVQMERGADSVVDESLCPQSD
RPADSLPCLVDICPVGWDTKAEGGGGIAGSQSSSSSRDNKGFDVQTQVQWRHKSALAVMS
SAQAEPVFVWNPVIGRCSKSCGTGQRQVWYSCVDHLSRNQVLDVYCNGSSKPQPYTELCS
TDVCPPGWHYQQGVCSVSCGGGVAHRVLYCSRDTGFGEEITSDSECRGPLPSSRVPCNTD
PCPARWRAQEAGPCSASCGLGVAQRRVSCVRFQQGEDREVSEELCPPAQKPSAVEPCLMT
VCTFIWEVQEWGQCSVTCGNGIQSRAVSCVGPGHAQPLSPLLCMHLPKPITIQACHAHDC
APPEPTTWASGRSDTTPAAPGTPRPPQYQASTLPAPSATPTAPSETSVCGQLLLQSSGTV
DLRRASERDCTVTVGRPLDEIVHIEVESSSLDCRSREFVALYDRLMLVKKCERLSGYSLT
SHTNVLLIRQGLVAPGNGVLLTYRSQKSTKKGLYSDCDRQLFGSTGEIVNPTHLSDAALH
TCRVFINVRPSATIEIRALSIEPTLHGGAAQSTFVLIRDVRVMKTTVFGGNQLFLWRSSG
SMVEIEFHGGYLQAKGSFRAEYSTIEP
NT seq 4584 nt   +upstreamnt  +downstreamnt
atggcagcggctctgctcctctgggtcctgtgggtcctgccggcttcaacgctgtcgaga
agatcctcggcggaggagtattttcttcagttcttggatcagcaggatcttcttttttat
tttggtaccacctccatagcatcagtgcctgactttcagctcgtttggcctcgctgcccg
tccacggagccgtccatcaccccgtggcgttgttcagttgaggctcaggggagaaggtac
gagctgggcctgcctggaggaggttcgcccccatcctgtttttccttggaggacgtggtt
ttggactgctgcgctcggctccgggtgctgaagccccagtcggcccacgctaacctcacg
ttctgcggaggatcgctgagaggcctgctgctcacccagggaacatggctccacatccag
cccgtactgcagaggcaccagcagctggctggctcgtccgacggacccccagccacagca
cacctggtgttcccccggcccgtgttcgagggatcatcgcagggcctccctcgctcaaat
gtcaggctcaagcgcagttccaccatggggtcacaggtcacccacctggagctgctggtg
gtggcagggccagatgtgcagcaggtgcacaggcaagacactgagaggtacatcctcacc
aatctcaacattgcctctgagctgctcagggacatctctctgggggccagtctgagggtc
cacctgattcgcatcataatcctgacggaacctgagccagagatccaaatcacgggcaac
atcacctcctccttgatgagcgtgtgccagtgggggcatagggtgaaccccaccaatgac
acggaccccctgcatgccgacctgctgctttatattacacgatttgaccttcagctgccg
gacgggaacaagcaagtgcggggagtagcccagctgggtggagcctgttccagccagtgg
agctgtgttattacagaggacacggggttcgacctgggcatcaccattgcgcacgaaatt
ggccacagcttcggcatcaatcacgatgggacgggcaacacctgcagtagcagcgggttc
attatggcgtccgatggcggctacaacagtgtggacctcagctggtctcagtgcagccgt
gaccaactccagagcttcctcagttctgaccacggcgagtgcgtaaaggacttgcccttg
ctcggaggctctctgcaggactggaagccaggcttgtactatggcatcgatgaccaatgc
cgcatcgccttcggcaacgttgccagggcctgttccttcaacaccggggacattgatatg
tgtcgcgtactgtcctgccacgtcgtccctggtgaccagagctcatgcactcgactgtta
gttcccctgcttgatggaactgagtgtgcgcccaatcagtggtgtctgaaggggcgctgc
gtctccccatcccagttgagctcctccatggcagtgcacggctcctggtccagctggtcg
gagttctccccctgctcccgcacctgcggcggtggggtcagcgctaggaggaggcagtgc
aacaatccacgacctgcctttggagggaacaattgcaagggcccggacaccgaggccgaa
ctgtgtaacatgcagccctgtcccaggacccagctggagttcatggaggagcagtgctca
atgacagactcccagcccctgtacctgtcctccagcgatgccactgggtaccactggatc
tctgccgtgggctacgttacaggagacctccagtgcaagctcatgtgccgctcccagggc
gaggacttcatggtgagccgtggagcgcggtttgtggacgggacgcggtgcgagcccagc
agtctggctccgaccggttctgtctcggcttgcttggcggggacgtgccagctgtttgga
tgcgatgggctgctgaattctgggaaggtgaaggacgcgtgtggggtgtgtggaggagat
ggctcatcctgcagtctcgtttctgattcctacacggagggtcacgccaaagagtatacc
acattcttgacccttcctcagaatgcaactcaagttcacattgtcaacaccaggcccatc
ttcacacacttggctgtgctagtccaaggcaagtatgtggtggctggaactggcagtgtg
tccctgaacaccacacacccctcccctctagaggacggacggttaacgtacctcctctac
ctcacccctgacctcctgccccacaaagaggagctgttgttacctgggccggtagaagag
gacattcacatacaggtgtatcgaaagtacggaaaagaatacggagaagcaaccagcccg
aatatctcctactctttttacgcaccgggaactgcgagcaaaaccagagccaagtggaca
actcgcatgacaacctgttctgtcacctgtggatcaggaacacagcagactattgctctg
tgcgtgagtgaagatggtgatgaacatctgtcagagacctcctgtgaagcgacccctcgt
ccccccttccttgaggtcccctgtcaccttgcggcctgccctccctactgggaaacaggg
gactttggcccctgcagtgtttcctgtggtggaggtgagatggtgcgctctgtgaggtgt
gtccagaggcagggggccgagctcctccagcggccggcctccgagtgtccgcaagactcg
gctccgccctctctgagcgcctgcagcccagagccctgcccagcgaggtggcgggtgtcg
aaccctggagagtgctcggccgcgtgtggaccagggacggcctggcgcgtggtgtcctgc
gtacagatggagcggggcgcggactccgtcgtggacgagagcctgtgcccgcagtctgac
cgtccagcggacagcctgccctgcctggtggacatctgtcctgtgggctgggacacaaag
gccgagggaggaggcggcatcgcggggagccagagttcgagttcctctcgtgacaataaa
ggctttgatgtgcagacccaggttcagtggcgacacaaatcagcgctcgccgtgatgtca
tcggctcaggcggagcctgtctttgtatggaaccctgtgattggccggtgctcaaagagc
tgcgggactggacaaaggcaggtgtggtactcctgtgtggaccacctgtccaggaaccag
gtgctggatgtctactgcaacggttcgagtaaaccccagccgtacacagaactgtgcagc
actgacgtctgcccccccgggtggcactaccagcagggggtgtgcagtgtttcgtgtggc
gggggggtggcacacagggtgctgtactgctcccgggacactggttttggggaagagatc
accagcgactctgagtgcagggggccactcccctccagcagggtaccatgtaacacggac
ccatgccctgccagatggagggcacaggaggcaggaccctgctcggcatcctgtggtctc
ggtgttgcccagcgccgtgtgtcctgtgtccggttccagcagggtgaagacagggaagtg
tcggaggagctgtgcccccctgcccagaaaccctcggccgtggagccgtgcctgatgaca
gtctgtaccttcatttgggaggtgcaggagtggggccagtgttcagtgacctgcggcaat
gggatccagtccagggcggtgtcctgcgtgggacccgggcacgcccagcccctgagcccc
ctgctgtgtatgcacctgcccaaaccaatcaccatccaggcatgccatgctcacgactgc
gctccccctgagcccaccacgtgggcctccgggagatcggacacaacgcctgcggccccc
ggaactcctcgcccacctcagtatcaggcatcaacgttacccgctccgtcagccacaccc
acagccccttcagagaccagtgtgtgcgggcagcttctgctgcagtcctctggcacggtg
gacctgaggcgcgcaagcgagcgcgactgcaccgtgaccgtcgggcgccctctggacgag
attgtccacatcgaggtggagtccagctccctggactgcagaagcagggagtttgtagcg
ctctacgacaggctgatgctggtaaagaagtgcgagcggctgtccggctattccctgacc
agccacaccaacgtcctgctgatacggcagggcctggtcgcccccggcaacggcgtgctg
ctaacctaccgcagccagaagtcaaccaagaagggtctctatagcgactgcgaccggcag
ctgtttgggtcgacgggcgagatagtgaatcccacgcacctgtcggacgccgcccttcac
acctgccgcgtcttcatcaacgtccggccttccgccaccatcgaaattcgtgccctgagc
atcgaaccgacgctgcacggtggcgccgcacagtccaccttcgtactgatccgtgatgtc
agagtgatgaagaccacggtgttcggggggaaccagctgttcctgtggcgctcgtcgggc
agcatggtggagatcgagttccacggggggtatctgcaggccaagggaagcttccgggca
gaatactccaccatcgaaccctga

DBGET integrated database retrieval system