KEGG   Scleropages formosus (Asian bonytongue): 108938663
Entry
108938663         CDS       T04919                                 

Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00230  Purine metabolism
sfm00240  Pyrimidine metabolism
sfm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    108938663
   00240 Pyrimidine metabolism
    108938663
Enzymes [BR:sfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     108938663
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 AAA_28 AAA_17 CoaE DUF5798
Other DBs
NCBI-GeneID: 108938663
NCBI-ProteinID: XP_018614996
Position
17
AA seq 263 aa
MSPVSKRSCPSPPNDSLGTRLKRISIEGNIAAGKSTFVQLLEDYSKDWEVVPEPIARWCN
VQTAHSEFEELTTSQKSGGNVLQLMYEKPERWAYTFQSYACMSRVRAQMKSTNGKIQEAE
NPVQFFERSVYSDRYIFAANLYESECLNDTEWAIYQDWHGWLHKQFGKHIELDGIIYLRA
SPEKCLERLHIRGRAEEQGIPLEYLEKLHFKHESWLQHKTMHMEFQYLNELPVLTLDVNE
DFKGKKAKCADMLEKVKEFLSTL
NT seq 792 nt   +upstreamnt  +downstreamnt
atgtccccggtttcgaagagatcatgtcccagtccccctaacgacagcctggggacacga
ctgaagagaatttccatcgaaggcaacattgcggcaggaaaatcgacatttgtgcaatta
ctggaggactacagtaaggactgggaggtagtacctgaacccatcgccaggtggtgcaat
gtgcagactgcacacagtgaatttgaggagctgaccacatctcagaagagtggagggaat
gttcttcagctgatgtacgaaaagccagagagatgggcctataccttccagagctatgcc
tgcatgagcagagtgcgtgctcagatgaaatctaccaatgggaaaatccaggaggctgag
aaccctgtgcagttctttgagagatctgtgtacagtgacagatacatatttgctgcaaac
ctttatgaaagtgagtgtttgaatgacactgaatgggcgatataccaggactggcatgga
tggctccacaaacagtttgggaaacatattgaactggatggtattatctaccttcgtgca
tcgcctgagaaatgcttggaaaggttgcatatacgagggagagcggaggaacaaggtatc
cccctggagtacttggagaagctccacttcaaacatgagtcttggctccaacataaaacg
atgcacatggaatttcagtatcttaatgaattacctgttttgacattggatgtaaatgag
gattttaaggggaagaaagcaaaatgtgccgatatgctcgaaaaggtaaaagaatttttg
agtacattgtag

DBGET integrated database retrieval system