KEGG   Scleropages formosus (Asian bonytongue): 108938941
Entry
108938941         CDS       T04919                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1-like isoform X1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sfm01002]
    108938941
Enzymes [BR:sfm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     108938941
Peptidases and inhibitors [BR:sfm01002]
 Metallo peptidases
  Family M1
   108938941
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N DUF4678
Other DBs
NCBI-GeneID: 108938941
NCBI-ProteinID: XP_018615480
Position
17
AA seq 948 aa
MLLPGIRMELQTLLYFCGLQVLVVILNLCPSVAVTEKQSEEKHKATSPFTIKNQALPWDN
IRLPQAVKPLHYDLLIHPNLTSLDFTGFVQIQLEVLQETSAIILHSKDLHISKAELVESG
RTHPLQVLELPSNQQVALLSSDVIVKGRQCAVSLTFAANLSETFHGFYKSTYRTRNGDVR
VLASTQFEPTSARSAFPCFDEPAFKANFSIRIRREARHVALSNMPRVKTVELPDGILEDH
FDTSVKMSTYLVAFLVSDFVSISKTSLHGVKISVYTEPEKISQAEFALDAAVKLLDFYED
YFDIPYPLPKQDLAAIPDFQVGAMENWGLTTYRESALLFDPTKSSASEKLGITMIIAHEL
AHQWFGNLVTMQWWNDLWLNEGFAKFMEFVSVSVTHPELQVEDIFLDKCFSAMEVDALSS
SHPVSTHVENPTQIEEMFDDVSYEKGACVLNMLQDFLSADAFKNGIVRYLRRYSYKNTVT
SDLWNSLTNVCEHDEQDEGRPRGDGFCSRTESQPAASDKLDVQGMMDTWTLQEGFPLISV
EVKGREVRLSQERYLKSAESSKTSGFLWHIPLTYMTSKSSTVHRFLLTTKTDVLYLPGEV
DWIKFNVDMNGYYIVHYEAGGWDTLTDLLQRNHMALSSNDRASLISSIFQLVSIGEVPLD
KALDLSLYLSKERHIMPVMQGFSELVPLYKLMEKRDMEDLEKQMKGYIVNLFRDLIDLQS
WTNDGSVSERRLRSYLLLFACVRGYQPCVDKATALFVKWKKSNGTMSLPSDVSLAVYFVG
ARSPEGWDFLFETYRHSLYTSLKFQIKAALTSSPLTEKLRWIMEQSLEGDVVKTQDLPSV
LVSVSKNPKGYKHAWDFLRANWDRLVKKFELGSQTIANIVTEVTGSYSTKEMLEEVRSFF
SSKLEGTGMELRCVQQALENIEENIRWTDKNLPLLKAWLDRQGSLQRE
NT seq 2847 nt   +upstreamnt  +downstreamnt
atgctgttgccaggcataaggatggaactgcaaactttgctgtacttctgtggtcttcaa
gttctagtggtcattctcaacctttgtccctctgtcgcagtaacagagaaacaaagtgaa
gagaagcacaaggcaacgtctccgtttaccatcaagaaccaggcattgccttgggataac
atcaggcttccacaagctgtcaaacctttgcattatgatctccttatccaccccaactta
acttcccttgatttcactgggtttgttcagatccagttggaagttttgcaggagaccagc
gctatcattctacacagcaaggacttgcacatctccaaggcagagcttgtagaatcaggc
agaactcatcctcttcaggttctcgaacttccatccaaccagcaagtggctcttctgtcc
agcgatgtcatagttaagggtcgtcagtgtgcagtttccctcacatttgctgccaatctt
tccgagacctttcacggcttctacaaaagcacgtaccgtacacgcaacggagatgtcaga
gttcttgcctccacgcagtttgagcccaccagcgcacgctctgccttcccctgctttgat
gaaccagctttcaaagctaatttctctattcggatccgtcgagaggccaggcacgttgct
ctctccaacatgccaagggtgaagacagtcgagctgcccgatggaatcctggaggaccac
tttgacaccagtgtgaagatgagcacctacctggtggcttttcttgtgtctgactttgtg
tccatcagcaagaccagcctgcatggagtcaagatttcggtatacacggaacctgagaag
atctcccaggcagagtttgcactggatgctgcagtgaagctcctagacttctatgaggat
tactttgacatcccatacccactacccaaacaagacttggctgctatacctgacttccag
gtgggagccatggagaactggggtcttacaacctaccgggagtctgctcttctatttgat
cccacaaagtcctcggcttccgagaagctgggaatcaccatgattattgcccatgagctg
gcgcaccagtggtttggaaacctggtgaccatgcagtggtggaatgacctgtggctcaat
gagggatttgcaaagtttatggagtttgtatcagtcagcgtcacccaccctgagctgcaa
gtggaagatattttcctcgacaagtgtttctcagcaatggaagtggatgctctgagctcc
tcacatccagtctccacccatgtggagaaccccacacagatagaggaaatgtttgatgat
gtctcgtatgaaaagggagcttgcgtcttgaacatgttgcaggatttcctcagtgccgac
gcttttaaaaacggaattgtccgctacctccggcggtacagctacaagaacacggtgacc
agtgacctatggaatagtctgactaatgtctgtgagcatgatgagcaggatgaggggcga
ccgagaggcgatggtttctgctccaggaccgagtcccagcctgcagcttcagacaaactg
gacgtgcaggggatgatggacacctggacattgcaagaagggttccctctgatcagcgtg
gaggttaaaggtcgagaggtccgattaagtcaagagagatatcttaaaagcgcggagtct
tcgaagacgtcagggttcctgtggcacattccactaacctacatgaccagcaagtccagc
acagtccatcgctttcttctaacaaccaaaaccgatgttctgtacctgccgggtgaggtg
gactggatcaaattcaatgtggacatgaacgggtattacattgtccactatgaggcagga
ggctgggatactttgactgatctgctccagcggaaccacatggcgctgagtagcaatgac
agggccagtctcattagcagcatctttcagctcgtcagcataggggaagttccactcgac
aaagccttggacctgtcgctgtacctgagcaaggagaggcatatcatgccagtgatgcag
gggttcagtgagctcgtgcccctctacaaactcatggagaagagggacatggaagacctg
gagaaacagatgaagggctacattgtgaacctcttccgagatctgattgacctccagtcg
tggactaacgatggctcggtgtctgaaaggaggctgcgcagctacttactgctctttgca
tgcgtgcgtggttaccagccgtgcgtcgacaaagccaccgctctctttgtcaagtggaag
aagtccaatggcaccatgagtcttcccagcgatgtgagcctggcggtttactttgtgggt
gcccgctctcctgagggatgggacttcctctttgagacataccgccattccttgtacaca
tcactcaagttccagattaaagctgcgctcaccagcagccctctgacggagaagctccga
tggataatggagcagagcttggaaggagacgtggtgaagacccaagacctgccttcagtg
ctggtcagcgtcagcaagaacccgaagggctacaagcacgcctgggacttcctgagagca
aattgggacaggctggtgaagaagtttgaacttggatctcagaccatcgcaaacattgtg
actgaagtgaccggcagctactccaccaaggagatgctggaagaggtgcgcagtttcttc
agctccaagctggaggggactggaatggaactgcgctgtgtccagcaggcactggagaac
attgaagagaacatccgctggacagacaagaaccttcctctgcttaaagcctggctggac
aggcaaggttcactgcagagagaataa

DBGET integrated database retrieval system