KEGG   Scleropages formosus (Asian bonytongue): 108939677Help
Entry
108939677         CDS       T04919                                 

Gene name
minpp1
Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00010  Glycolysis / Gluconeogenesis
sfm00562  Inositol phosphate metabolism
sfm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108939677 (minpp1)
   00562 Inositol phosphate metabolism
    108939677 (minpp1)
Enzymes [BR:sfm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     108939677 (minpp1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     108939677 (minpp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 Strep_SA_rep
Motif
Other DBs
NCBI-GeneID: 108939677
NCBI-ProteinID: XP_018616714
UniProt: A0A1W5AM39
Position
Unknown
AA seq 465 aa AA seqDB search
MRDVLSKSFVLTALSFALARVYSYLAGDAPVTARRIPSIAAYFGTKGRYEEVNPHLIDNI
LAVNKLLLKPPSADCTAVHLTAIVRHGTRFPTKKNVKKMMELHKLIKAEASSPERWLEDI
KNKWAMWYTEDMDGQIVDKGRDDHKHLAVRLANYFPSLLSEENLRNNRVKFITSSKHRCV
ESVIAFQQGLFTHHGIKDVDFSHEVKDDLMRFFDHCRRFVEDVENNRTALMEVDLFKSSA
EMKRVQEKIADRLDVPYSRITTDSVEAAFFLCAYEFAIKSENSPWCELIDETDALVLEYK
NDLKQYWKRGYGHDINRKSSCTLFHDIFRRLSEAVNELRTGHVTEVATVQVGHAETLLPL
LTLMGFFKDETPLTSSNFPEQERRTFRTSHTVPYAANLVFVLYKCPEGPRLQLLLNEKPL
ALPNISDPVPLYDIVQEHYRDLLQGCNFQTECELKASTCSKCSEL
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgagagacgttttatcgaaaagttttgtgctcacggctctaagctttgccctggctcgg
gtttattcgtacctcgctggagatgccccggttacagcgagaagaataccttcgattgcg
gcatattttggcacgaaaggccgatacgaagaagtgaatcctcatcttatcgacaacatt
ttggccgtgaacaagttgctcctgaagccaccgtctgctgactgcactgcggtccacctc
accgccatcgttcggcacggcacaaggttcccgactaaaaaaaacgtgaaaaagatgatg
gagctccacaagctcataaaggcagaagccagcagccccgaacggtggttggaagacatt
aaaaacaaatgggcaatgtggtacactgaggacatggacggacagatcgtggacaaaggc
cgagatgatcacaaacacttggcagtaagactagctaactactttccatccttactatct
gaggaaaacctcaggaacaaccgagtcaaattcataaccagctccaaacacaggtgtgtg
gagagcgtcatcgcctttcagcaaggcctcttcactcaccacggaatcaaagatgtggat
ttcagccatgaagtcaaggatgacctgatgcgattctttgatcactgcagaaggtttgtt
gaagatgtcgaaaataacaggacggccctcatggaggtggacctgttcaaatcttcagca
gagatgaaacgggtccaggagaagatagctgatcgtctggacgttccatacagtcgcatc
acaacagattctgtcgaggctgcatttttcctctgcgcttacgagtttgccattaagtct
gagaactctccatggtgcgagctcattgatgaaacagatgccctggtgctggaatataaa
aatgacctgaagcagtactggaagaggggttatggccatgacattaaccgcaaatccagc
tgcactctctttcacgacattttcaggcgtctcagtgaggctgttaacgaactcaggaca
ggtcatgtgactgaagttgccactgttcaggtgggtcatgcagagaccctcctgcccctg
ctcacacttatgggcttcttcaaggacgaaacgcccttgacctcctccaactttccagag
caagagaggcgcaccttccgcacgagccacacggtgccatacgccgccaacctcgtcttc
gtgctctacaagtgccccgaggggccgaggctgcagctgctgctcaacgagaagcccctg
gctttgcccaacatcagtgaccccgtgccgctgtacgacattgtccaggagcactacagg
gacctgctgcagggatgtaacttccagacggagtgcgagctgaaggcgtccacctgcagc
aagtgctcggagctttaa

DBGET integrated database retrieval system