KEGG   Scleropages formosus (Asian bonytongue): 108940231Help
Entry
108940231         CDS       T04919                                 

Definition
(RefSeq) monoglyceride lipase-like
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00561  Glycerolipid metabolism
sfm01100  Metabolic pathways
Module
sfm_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    108940231
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sfm01002]
    108940231
Enzymes [BR:sfm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     108940231
Peptidases [BR:sfm01002]
 Serine Peptidases
  Family S33
   108940231
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Lipase_3 Esterase Abhydrolase_2 DLH Thioesterase PGAP1 LIDHydrolase DUF1350 Abhydrolase_5 Chlorophyllase2 DUF1057
Motif
Other DBs
NCBI-GeneID: 108940231
NCBI-ProteinID: XP_018617744
UniProt: A0A1W5AQ38
Position
Unknown
AA seq 268 aa AA seqDB search
MISYAKKWALVFVVHGAAEHCECYSDLAQNLTKQDLLVFAHDHVGHGKSEGDRLVVKDFQ
VYIRDSLQHIDLMKERYPGLPIFFIGHSMGGAISILTACERPGDFAGVVLIAPLIQLNPD
TATDFKVAVAKLLNHMVPNLSLGAIEPKWISRDQKQVEAYEKDELIYHRGLRVSFAVQLM
NAVERIEKAVPTIGWPFLLLHGDVDKLCDIRGSQVMFEKAPSSDKEMKVYEGAYHALHHE
LPEVADSVWKEINTWIKKRIPIQPSSGS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgatcagctatgcaaaaaaatgggcactggtgttcgtagttcacggagcagcagagcac
tgcgagtgctacagcgaccttgcccagaacttgaccaaacaggacctgcttgtcttcgcc
catgatcacgtgggtcatggaaagagcgaaggggacaggttggtggtcaaggacttccag
gtgtacatcagagactcgctgcaacacattgaccttatgaaggagcgctaccccggcttg
cccatcttcttcatcggacactcaatgggcggagccatctcgatcctgactgcctgcgag
cgccccggtgattttgctggggtggtgttgatcgcacccctgattcagctgaaccctgat
acggccacggacttcaaggtggccgtcgctaaacttcttaaccacatggtgccaaaccta
tctttgggtgccattgagcccaagtggatctcgcgggaccagaagcaggtggaggcatac
gaaaaggacgagctcatctaccacaggggcttgcgggtctcgttcgccgtgcagctgatg
aacgccgtggagcggatcgaaaaggccgtgcccactatcgggtggcctttcctgctgctt
catggggacgtggataaactctgtgacatccgaggctcccaggtgatgtttgagaaggcc
ccgagttctgacaaggagatgaaggtgtacgaaggtgcataccatgcgctccaccacgag
cttccagaggttgcggactcggtttggaaggagatcaacacctggataaagaagcgcatc
cccatacagccgtcgtcgggttcctag

DBGET integrated database retrieval system