KEGG   Scleropages formosus (Asian bonytongue): 108940276Help
Entry
108940276         CDS       T04919                                 

Definition
(RefSeq) MAP kinase-activated protein kinase 2-like isoform X1
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm04010  MAPK signaling pathway
sfm04218  Cellular senescence
sfm04370  VEGF signaling pathway
sfm04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108940276
   04370 VEGF signaling pathway
    108940276
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    108940276
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    108940276
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sfm01001]
    108940276
Enzymes [BR:sfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108940276
Protein kinases [BR:sfm01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   108940276
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like Pkinase_fungal Glycogen_syn
Motif
Other DBs
NCBI-GeneID: 108940276
NCBI-ProteinID: XP_018617813
Position
2
AA seq 388 aa AA seqDB search
MLSNQKNQKPPGLSQQNNAPSSLSLPPAPPPPPPVHVRPALQMKKHAITEEYKVTSQVLG
LGINGKVLEVFHKKNGQKYALKMLQDCPKARREVELHWRASACSNIVHIVDIYENLYQNR
RCLLIIMECMEGGELFSRIQDRGDQAFTEREASCIMKSIGEAIQFLHANNIAHRDVKPEN
LLYTSKKPNAILKLTDFGFAKETTLHNSLATPCYTPYYVAPEVLGPEKYDKSCDMWSLGV
IMYILLCGYPPFYSNHGLAISPGMKKRIRMGQYEFPRSEWSDVSEEARRLIRHLLRTDPT
QRMTITEFMNHPWINQSMIVPQTPLHTSRVLKEEKDTWEDVKEEMTSALATMRVDYDQVK
IKTIEDSSNPLLLKRRLKANTASKKPTG
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgctgtccaaccagaagaaccagaagccgccgggcttgtcgcaacagaacaacgcgccg
tcgtcgctgtcgctgccgccggcgccgccgccgccgccgcccgtccacgtgaggcccgcg
ctccagatgaagaagcacgcgatcacggaggagtacaaagtcacgagccaggtgctcggg
ctcggcatcaacggcaaggttctggaggtcttccacaagaagaacgggcagaagtacgcc
ttgaagatgctgcaggattgcccaaaggcgcggcgcgaggtggagctacactggcgtgcc
tctgcctgcagcaacatcgtgcacattgtggacatctatgagaacctctaccagaacagg
aggtgtctgcttatcatcatggagtgcatggaaggtggagagttgttcagtcgcattcag
gaccggggggaccaggcgttcactgagcgagaagcctcatgcatcatgaagagcatagga
gaggccatccagttcttgcatgccaataacattgcgcacagggatgtcaagccagagaac
ctgttatatacttccaaaaagccgaacgcgatcctcaaactgacggactttgggttcgct
aaagagaccacgctgcacaactcgctggccacaccatgctacactccctactatgtggct
ccagaagtccttggtccggaaaagtatgacaagtcatgtgacatgtggtccttgggtgtc
atcatgtatatcctactgtgtgggtatcctcctttctactccaaccatggtctggccatt
tctcctggaatgaagaagcgaatccgcatggggcagtatgagtttcccagatcagaatgg
tcagatgtctcggaggaagcaaggaggctcatccgacacctgttacgaaccgatccaaca
cagaggatgacaatcacagagttcatgaaccatccttggatcaatcagtccatgattgtc
cctcagacccctctccacaccagccgagtgctgaaggaggaaaaggacacctgggaggat
gtcaaggaggagatgaccagcgccttggcgacgatgagagttgactacgatcaagttaag
atcaaaacgatcgaggactcatccaatccgctgctgctgaagaggaggctgaaggcgaac
acagccagcaagaagcccaccggttga

DBGET integrated database retrieval system