KEGG   Scleropages formosus (Asian bonytongue): 108940347Help
Entry
108940347         CDS       T04919                                 

Definition
(RefSeq) erlin-2 isoform X1
  KO
K23341  erlin
Organism
sfm  Scleropages formosus (Asian bonytongue)
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sfm04121]
    108940347
Ubiquitin system [BR:sfm04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ERAD complex
    108940347
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7 ThiI
Motif
Other DBs
NCBI-GeneID: 108940347
NCBI-ProteinID: XP_018617956
Position
12
AA seq 329 aa AA seqDB search
MTQLGAVASVVLGVVVAALYSTIHKIEEGHTGVYYRGGALLTTTSGPGFHLMLPFITSFR
SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPTAVYDIVKNFTADYDKALIFNKV
HHELNQFCSSHTLQEVYIGLFDQIDENLKLTLQQDLTAMAPGLIIQAVRVTKPNIPESIR
RNYELMESEKTKLLIAAQTQKVVEKEAETERIRAVIEAEKLAQVAEIKFGQKVMEKETEK
RISEIEDGAFLAREKARADAEYYRAHRTAEANKLKLTPEYLQLMKFKAIAANSKIYFGRD
IPHMFVDSGPGGATSGASSETDISENSLD
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagctgggcgccgtcgcctcggtggtcctgggtgtggtggtggcggctctctac
tccaccatacacaagatcgaggagggtcacactggagtttattacaggggaggtgctctt
ctcaccaccaccagtggtcctgggtttcacctcatgctgccctttattacctccttcagg
tctgtgcagaccaccctacaaacagatgaagtgaagaatgtgccttgtggtacaagcggt
ggggtcatgatctacttcgaccgaatagaagttgtaaacttccttgttcctacagctgtg
tacgacattgtgaagaacttcaccgcagactatgacaaagctctaattttcaacaaagtc
caccacgagctcaaccagttctgcagttctcacactctgcaggaggtctacattggcctt
tttgatcagattgatgagaatctgaagctgacgttgcagcaggacctgaccgctatggct
cctggccttattatacaggctgtccgagtcacaaagcccaacattcccgagagcatacgg
cggaactatgagctcatggagagtgagaagacaaagctactgattgcagctcagactcaa
aaagtggtggagaaggaggcagagactgagaggatacgagctgtgattgaggctgaaaag
ctggctcaggtggctgaaatcaagtttggtcagaaagtcatggagaaggaaactgagaaa
aggatatctgagattgaagatggagccttcttggcacgagagaaggcgagagcagatgca
gagtattacagagcccacagaacagcagaggctaataagttgaagctcaccccggagtac
ttgcagctaatgaaattcaaggccattgcagccaacagcaagatttattttgggagagac
attccacatatgtttgtggactcgggacctggtggggccacttctggggcctcctcagaa
acggacatctcagagaactcacttgattga

DBGET integrated database retrieval system