KEGG   Scleropages formosus (Asian bonytongue): 108941228Help
Entry
108941228         CDS       T04919                                 

Gene name
acsbg1
Definition
(RefSeq) long-chain-fatty-acid--CoA ligase ACSBG1
  KO
K15013  long-chain-fatty-acid--CoA ligase ACSBG [EC:6.2.1.3]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00061  Fatty acid biosynthesis
sfm00071  Fatty acid degradation
sfm01100  Metabolic pathways
sfm01212  Fatty acid metabolism
sfm03320  PPAR signaling pathway
sfm04920  Adipocytokine signaling pathway
Module
sfm_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    108941228 (acsbg1)
   00071 Fatty acid degradation
    108941228 (acsbg1)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    108941228 (acsbg1)
   03320 PPAR signaling pathway
    108941228 (acsbg1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sfm01004]
    108941228 (acsbg1)
Enzymes [BR:sfm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     108941228 (acsbg1)
Lipid biosynthesis proteins [BR:sfm01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   108941228 (acsbg1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-GeneID: 108941228
NCBI-ProteinID: XP_018619431
Position
11
AA seq 744 aa AA seqDB search
MRTGSIRERCFFMPTLGRCSSATFTRPLTGMSTTKCSAATPDHNENHQESCVEELGDRLV
LSAQRFMTDLKKEAEEAVGVKSREEKESVEEVLSNVSLAPAQSLWTTEASGSVKLRMDED
CLQEPITVHQMFKASVEKYNSLWALATRKKDKWEKITFSEYYHRCRTAARSFLKLGLERF
HSVAILGFNSAEWFFSAVGTIFAGGVMTGIYATNSPEACHHVASDSKANIIVVENQKQLD
KILQVRDRLPHLKAIVQYSGPLQKTVSNLYSWEEFMELGQDIPEKDLDEIIRSQKANQCC
VLIYTSGTTGKPKGVMLSHDNITWTAHHASRAGDVQPANSRQESLVSYLPLSHIAAQIYD
LWTGIQWGELVYFAQPDALKGTLISTLKDVHPSSHMGVPRVWEKMMEKIKEGIAHSGYLK
KKMVTWAMTLSLEAHQKGINKGEERPFLFSLADSLVLEKLRAELGLSECLKFFSGAAPIG
KETVEFFLALNIILYEAYGMSESTGPHFMSGPKAYRLASCGKVVPGCKFKLANEDGDGNG
EVCFWGRNVFMGYLNLEDKTRETLDKDGWLRSGDLGRADKDGFLYITGRMKELIITAGGE
NIPPLPIEDAVKKEIPIISNAMLIGDNRKFLSMLLTLKCSFNAETMEPTDNLSLEALECC
QQLGSQAKKVSDITGEKDKEVYQFIQNGIDNVNSRAVSNAQRIQKWTVLPKDFSVSGGEL
GPTMKLRRPVVLELYRQEIEKFYM
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacgggctccattcgcgagcgctgcttctttatgccaactttgggaaggtgtagc
agcgcaactttcactcggccgctgacgggcatgtccaccacaaagtgctccgctgcgact
ccagatcacaacgaaaaccaccaagaatcatgtgttgaggaattaggagaccgtcttgtg
ttgtcagcacaacggttcatgacagatctgaagaaggaggcagaagaggctgttggagtc
aagtcacgggaagagaaggaaagtgttgaagaagtcctcagcaatgtgtccttggcacct
gcacagtccctttggaccacagaagccagtggttcggttaaactacgaatggatgaagac
tgtctgcaagaacccatcactgttcatcagatgttcaaagcatctgtagagaaatacaac
agcctgtgggctctggctactaggaaaaaggacaaatgggaaaagatcaccttttcagag
tactatcatcgctgtcgaactgcagctagaagtttcctgaagcttggtttggagcgattt
cacagtgtggcaattctgggattcaattcagctgaatggttcttctcagctgttgggacc
atttttgcaggaggagtaatgacaggaatctatgccacaaactctccagaggcctgccat
catgttgccagtgactccaaagcaaacatcattgtggtagaaaatcaaaaacagctcgac
aagatcctccaggttagggataggctaccacatctaaaagccatagtgcaatactctgga
cctcttcagaagactgtgtccaatttatattcatgggaggagtttatggaactaggacag
gatatccctgagaaagatctggatgagatcataaggagccaaaaagccaatcaatgttgt
gtactgatttatacatctggaactacagggaagccaaaaggagtgatgctcagccatgac
aatatcacatggacagcccaccatgccagccgggcaggggatgtgcaaccggccaactcc
cgccaagaatccctggtcagctacctgcctctcagccatattgctgctcagatctatgac
ctatggactggcattcaatggggggaacttgtttactttgcacagcctgatgcattaaag
ggaactttaataagtacattgaaggatgtccatccttcatctcatatgggtgttcctcgg
gtctgggagaagatgatggagaagataaaagaaggcatagcccactctgggtatttgaaa
aagaagatggtgacttgggcaatgactttgagtttggaagcccatcagaaggggataaac
aagggtgaggagcggccctttctatttagtcttgcagacagccttgtattagagaagctt
cgtgctgaactgggcctttctgagtgcttgaagttcttctctggggcagcccccattggc
aaagaaacagtggaattcttcttggccctcaacattattctgtatgaagcctatggcatg
agtgagagcacaggacctcattttatgtcaggtcccaaagcttacaggctggccagctgt
ggaaaagtggttcctggttgcaaattcaagctagctaatgaagatggagatgggaatgga
gaggtgtgcttctggggccggaatgtcttcatgggctacctcaacctagaggacaagacc
agggagactttggacaaagatgggtggcttcgctcaggtgacctagggagagcggacaaa
gatggtttcttgtacatcactggaaggatgaaggagttaatcatcacagctggaggagaa
aatattcctccactaccaatagaggatgcagtgaaaaaggagattcccattattagcaat
gccatgctcattggtgataacaggaagttcttgtcaatgctgctaactctgaagtgttcg
ttcaatgctgagacaatggagcccaccgataatttgagtttggaggctttggagtgctgt
cagcagctgggcagtcaggccaaaaaagtgtctgacattaccggggaaaaagataaagag
gtttaccagttcattcaaaacggaattgataacgtgaactccagggccgtttccaatgct
cagcgcatacagaagtggactgtactgccaaaggacttctcagtctccggaggggaacta
ggtccaacaatgaaattacgacgacctgtggtgctggagctgtacaggcaagaaatcgag
aaattttatatgtaa

DBGET integrated database retrieval system