KEGG   Scleropages formosus (Asian bonytongue): 108941283Help
Entry
108941283         CDS       T04919                                 

Definition
(RefSeq) leukotriene B4 receptor 1-like isoform X1
  KO
K04296  leukotriene B4 receptor 1
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108941283
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:sfm04030]
    108941283
G protein-coupled receptors [BR:sfm04030]
 Rhodopsin family
  Lipid
   Leukotriene
    108941283
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7TM_GPCR_Srx Pox_P21
Motif
Other DBs
NCBI-GeneID: 108941283
NCBI-ProteinID: XP_018619520
Position
11
AA seq 372 aa AA seqDB search
MSACSNLTTMTNEPDTFQNTIPPDLPAITTSSPKPPPVGVGISFLVAALVVGLPGNLFVV
WTVLCRLRRKSITTLLVLQLAVADSFVLLTAPFFLRQLAINGIWEFGDWACRLLHYSCGV
NMYISVYLITLMGADRLLGVSRPFLSQRVRTKSRLWPTTGAVLIVALLLSIPVAVYREEK
KQKNNSYCLAHYPSKEHEVFHYCLETVAAFLLPFSALAVCYCRISRTLQAARVRWRQRNR
KGTSRLIVLIMGSFILLWAPYHFVNVLQTAALLAGKPGESLLSGCKKARPILIALAFLSS
SINPLLYACAGSTFMGTSGLSCITRLLEGTSSECNSKRLESRGEKGDGGKQSAGSLRMTE
VQDNKDNDEQKE
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcatgttcaaatctcacgaccatgacgaatgaaccggatacatttcagaatacc
atccctccggacttacctgcaatcaccacttcttctccaaagccgcctcctgtgggtgtt
ggtatttccttcctggtggcagccttagtagtgggtctccctggcaaccttttcgttgtt
tggacagtcctatgccgcctacgccggaagtctatcaccaccctgctggtcttgcagctg
gcggttgcggacagcttcgtgttgctaactgcaccctttttcctgcggcagttggccatc
aacgggatctgggagttcggggactgggcctgccgcttactgcactacagctgtggtgtt
aacatgtacatcagtgtctacctcatcactctgatgggggccgatcgcctcttgggagtg
tcccgtcctttcctgtcccagcgggtccgcaccaagtcccgcctctggccgacaacgggg
gccgtcttgatcgtggcactgctgctctccatccctgtggccgtgtaccgagaagaaaag
aagcagaaaaataacagctactgcttggcccactacccaagcaaggagcatgaggtcttc
cattactgtctggagacggtggcagccttcctccttccgttcagcgcattggccgtctgc
tactgccgcatctcccgcaccctgcaggctgcccgggtccgttggcgtcagcgcaaccgt
aaaggcaccagccgcctcatcgtcctcatcatgggtagctttatcctcctctgggcgccg
taccacttcgtgaacgtgctgcagacggcggcgctcttggccgggaaaccgggggaaagc
ctgctttcaggctgcaagaaagcacgccccattctcattgccctggccttcctcagcagt
tccatcaaccctctgctgtacgcttgtgccggatcaaccttcatgggcacctctggactg
agctgcatcactcgcctgctagagggcacctcctctgagtgcaacagcaaaagactggag
agtcgcggtgaaaagggagatggagggaaacagagcgccggttctctgagaatgacggag
gttcaggataataaggacaatgatgaacagaaagaataa

DBGET integrated database retrieval system